KEGG   Burkholderia cenocepacia J2315: BCAL0402Help
Entry
BCAL0402          CDS       T00771                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06195  ApaG protein
Organism
bcj  Burkholderia cenocepacia J2315
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BCAL0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: CAR50713
UniProt: B4E7B3
Position
1:435477..435851
Genome map
AA seq 124 aa AA seqDB search
MSQYQFTVSVKTSYLPEQSDPDHRQYAFAYTLTIRNTGQVAAQLIARHWIITDSESHVQE
VKGLGVVGHQPLLQPGEHFEYTSWAVIATPVGTMRGAYFCVAEDGERFEAPVDEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtatcagttcaccgtttcggtgaaaaccagctacttgccggaacaatccgac
cccgatcaccgtcaatacgcattcgcgtacacgctgacgatccgcaataccggacaggtc
gcggcgcaactgatcgcccgtcactggatcatcacggacagcgagagccacgtgcaggaa
gtgaagggactcggcgtcgtcgggcaccagccgctgctgcagccgggcgagcatttcgaa
tacacgagctgggccgtgatcgcgacgccggtcggcacgatgcgcggtgcgtacttctgc
gtggcggaagacggcgagcgtttcgaggcgccggtcgacgagttcgccctgcacatgccg
cgcacgctgcattga

DBGET integrated database retrieval system