KEGG   Burkholderia cenocepacia J2315: BCAL0423Help
Entry
BCAL0423          CDS       T00771                                 

Gene name
dnaA
Definition
(GenBank) chromosomal replication initiator protein DnaA
  KO
K02313  chromosomal replication initiator protein
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCAL0423 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcj03032]
    BCAL0423 (dnaA)
   03036 Chromosome and associated proteins [BR:bcj03036]
    BCAL0423 (dnaA)
DNA replication proteins [BR:bcj03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BCAL0423 (dnaA)
Chromosome and associated proteins [BR:bcj03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    BCAL0423 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA AFG1_ATPase ATPase_2 AAA_14 AAA_22 RuvB_N RNA_helicase AAA_24 AAA_16 TsaE
Motif
Other DBs
NCBI-ProteinID: CAR50734
UniProt: B4E7D1
Position
1:complement(467298..468875)
Genome map
AA seq 525 aa AA seqDB search
MNDFWQHCSALLERELTPQQYVTWIKPLAPVAFDASANTLSIAAPNRFKLDWVKSQFSGR
IADLAREFWNTPIEVQFVLDPKAGMRSAPAGAAPAAPRAPLAPNGPAATVAAIAANLTAN
ASAAPAAPADVPMTPSAAAARHLNADDADIDLPSLPAHEAAAGRRTWRPGPGAAPANGGE
ADSMYERSKLNPVLTFDNFVTGKANQLARAAAIQVADNPGISYNPLFLYGGVGLGKTHLI
HAIGNQLLLDKAGARIRYIHAEQYVSDVVKAYQRKAFDDFKRYYHSLDLLLIDDIQFFSG
KSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMR
VAILMRKAQSEGVNLSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHGREISIELTKEA
LKDLLTVQNRQISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSL
PEIGELFGGRDHTTVLHAVRKIADERSKDAQLNHELHVLEQTLKG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatttctggcaacactgttccgcactgctggagcgcgagctgacgccccagcag
tacgtgacgtggatcaaacccttggccccggtggccttcgatgcgtcggcgaacacgctg
tccatcgccgcgccgaaccgcttcaagctggactgggtcaagagccagttttcgggccgg
atcgccgatctggcccgcgaattctggaacacgccgatcgaagtccagttcgtcctcgat
ccgaaggccggcatgcgcagcgcccccgcaggcgccgcaccggccgccccgcgtgcaccg
ctggccccgaacggccccgccgcgacggtcgccgcgatcgccgccaacctgaccgcgaat
gcttccgctgcgcccgccgcgccggccgacgtgccgatgacgccgtcggcggccgccgcg
cgccacctgaacgccgacgacgccgacatcgacctgccgagcctgcccgcgcacgaagcg
gcggccggccgccgcacgtggcgtccgggcccgggcgccgcgcccgcgaacggcggcgaa
gccgattcgatgtacgaacgctcgaagctgaacccggtgctcacgttcgacaacttcgtg
accggtaaagccaaccagctcgcgcgcgcggccgcgatccaggtcgcggacaatcccggc
atctcgtacaacccgctgttcctgtacggcggcgtcggcctcggcaagacccacctgatc
cacgcgatcggcaaccagttgctgctcgacaaggccggcgcgcggatccgctacatccac
gccgagcaatacgtgtcggacgtggtgaaggcgtaccagcgcaaggcgttcgacgacttc
aagcgctactaccactcgctcgacctgctgctgatcgacgatatccagttcttctccggc
aagtcgcgcacgcaagaggaattcttctacgcgttcgaggcgctcgtcgcgaacaaggcg
caggtgatcatcaccagcgacacgtatccgaaggagatttcgggcatcgacgatcgcctg
atctcgcgcttcgattcgggcctgaccgtcgcgatcgagccgcccgagctggaaatgcgc
gtcgcgatcctgatgcgcaaggcgcagtcggaaggcgtgaacctgtcggaagacgtcgcg
ttcttcgtcgcgaagcacctgcgctcgaacgtgcgcgagctcgaaggcgcgctgcgcaag
atcctcgcgtattcgaagttccacggccgcgagatctcgatcgagctgaccaaggaagcg
ctgaaggacctgctgaccgtgcagaaccggcagatttcggtcgagaacatccagaagacc
gtcgccgacttctacaacatcaaggtcgcggacatgtactcgaagaagcgtcccgcgaac
atcgcgcggccgcggcagattgcgatgtacctggcgaaggaactcacgcagaagagcctg
ccggaaatcggcgagctgttcggcgggcgcgatcacaccaccgtgctgcacgcggtgcgc
aagatcgccgacgagcgcagcaaggacgcgcagctcaaccacgagctgcacgtgctggaa
cagacgctgaagggctga

DBGET integrated database retrieval system