KEGG   Burkholderia cenocepacia J2315: BCAL0687Help
Entry
BCAL0687          CDS       T00771                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00071  Fatty acid degradation
bcj00280  Valine, leucine and isoleucine degradation
bcj00281  Geraniol degradation
bcj00310  Lysine degradation
bcj00360  Phenylalanine metabolism
bcj00362  Benzoate degradation
bcj00380  Tryptophan metabolism
bcj00410  beta-Alanine metabolism
bcj00627  Aminobenzoate degradation
bcj00640  Propanoate metabolism
bcj00650  Butanoate metabolism
bcj00903  Limonene and pinene degradation
bcj00930  Caprolactam degradation
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01212  Fatty acid metabolism
Module
bcj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BCAL0687
   00650 Butanoate metabolism
    BCAL0687
  Lipid metabolism
   00071 Fatty acid degradation
    BCAL0687
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCAL0687
   00310 Lysine degradation
    BCAL0687
   00360 Phenylalanine metabolism
    BCAL0687
   00380 Tryptophan metabolism
    BCAL0687
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCAL0687
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCAL0687
   00281 Geraniol degradation
    BCAL0687
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCAL0687
   00627 Aminobenzoate degradation
    BCAL0687
   00930 Caprolactam degradation
    BCAL0687
Enzymes [BR:bcj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCAL0687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 TAF
Motif
Other DBs
NCBI-ProteinID: CAR50996
UniProt: B4E9N7
Position
1:749882..750709
Genome map
AA seq 275 aa AA seqDB search
MADLAAYGGYEALKVTRRDHGVLDIVMSGEGANRSGLATANARMHRELADIWRDVDRDPD
TRVAVIRGEGKGFSAGGDLALVEDMANDFDVRARVWREARDLVYNVINCSKPIVSAMHGP
AVGAGLVAGLLADISIAAKDARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYLMLCEP
VSGEEAERIGLVSLAVEPADLLPKAYEVAERLAHGSQSAIRWTKYALNNWLRTAGPTFDT
SLALEFMGFSGPDVQEGVRSLRERRPPAFPGDAPF
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcttgccgcgtacggcggttacgaagcactgaaggtgacgcgccgcgaccat
ggcgtgctcgacatcgtgatgagcggcgagggcgcgaaccgcagcggcctcgcgaccgcg
aacgcgcgcatgcatcgcgagctcgccgacatctggcgcgacgtcgatcgcgatcccgac
acgcgcgtcgcggtgatccgcggcgaaggcaagggcttttcggcgggcggcgatctcgcg
ctcgtcgaggacatggcgaacgatttcgacgtgcgcgcccgcgtgtggcgcgaggcgcgc
gacctcgtctacaacgtgatcaattgcagcaagccgatcgtgtcggcgatgcatggcccg
gccgtcggcgcggggctcgtcgccgggctgctcgccgacatctcgatcgccgcgaaggat
gcgcgcatcatcgacggccacacgcggctcggcgtcgcggccggcgaccacgcggcgatc
gtatggccgctcttgtgcgggatggcgaaggcgaagtactacctgatgctgtgcgagccc
gtgagcggcgaggaggccgagcggatcggcctggtgtcgctcgcggtcgagccggccgac
ctgctgccgaaggcatacgaagtggccgagcggctcgcgcacggttcgcagtcggcgatc
cgctggaccaagtacgcgctgaacaactggctgcgcacggccggcccgaccttcgatacg
tcgctcgcgctcgaattcatgggcttttcggggcccgacgtgcaggagggcgtccgttcg
ctgcgcgagcggcgcccgcccgcgttcccgggcgacgcgccgttctga

DBGET integrated database retrieval system