KEGG   Burkholderia cenocepacia J2315: BCAL0944Help
Entry
BCAL0944          CDS       T00771                                 

Definition
(GenBank) DJ-1/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BCAL0944
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bcj01002]
    BCAL0944
Enzymes [BR:bcj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     BCAL0944
Peptidases [BR:bcj01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   BCAL0944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI DUF2069
Motif
Other DBs
NCBI-ProteinID: CAR51251
UniProt: B4EBX4
Position
1:complement(1029319..1030002)
Genome map
AA seq 227 aa AA seqDB search
MTLHIGLLVFPGVQQLDLTGPHDVLASLPDAAVHLVWKSRDAVASSSGLALAPTCTFDDC
PPLDVICIPGGIGINELLLDAETIAFVQQRAATARYVTSVCTGSLLLGVAGLLRGRRATT
HWAFHALLEPLGAIPVRERVVRDGNLVTGGGVTAGIDFALTIAAELVGEEEAQAIQLQLE
YAPAPPFDAGSPDTAPAAVVKRVTERSAAGFAKRKQIVEHALRATPR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcatatcggccttctcgtctttccgggcgtccagcaactcgacctcaccggc
ccgcacgacgtgcttgcatcgctgcccgacgcggccgtccatctggtgtggaagtcgcgc
gacgcggtcgcgtcgagcagcggcctcgcgctcgcaccgacctgcacgttcgacgactgc
ccgccgctcgacgtgatctgcatcccgggtggcatcggcatcaacgagctgctgctcgat
gccgaaacgatcgcgttcgtgcagcagcgcgcggccaccgcgcgctacgtgacgtcggtc
tgcacgggttcgctgttgctcggcgtggccggcctgctgcgcgggcggcgcgcgacgacg
cactgggccttccatgcgctgctcgaaccgctcggtgcgatacccgtgcgcgagcgcgtc
gtgcgcgacggcaacctggtcacgggcggcggcgtgacggccggcatcgacttcgcgctg
acgatcgccgcggagctggtcggcgaagaagaagcgcaggcgatccagctgcaactcgaa
tatgcgccggcgccgccgttcgacgccggctcgcccgacaccgcgccggccgcggtcgtg
aagcgcgtcaccgaacgttcggccgccggcttcgcgaaacgcaagcagatcgtcgagcac
gcgctgcgcgcgacgccgcgctga

DBGET integrated database retrieval system