KEGG   Burkholderia cenocepacia J2315: BCAL1333Help
Entry
BCAL1333          CDS       T00771                                 

Definition
(GenBank) putative Acyl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00071  Fatty acid degradation
bcj00280  Valine, leucine and isoleucine degradation
bcj00410  beta-Alanine metabolism
bcj00640  Propanoate metabolism
bcj00650  Butanoate metabolism
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01200  Carbon metabolism
bcj01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BCAL1333
   00650 Butanoate metabolism
    BCAL1333
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCAL1333
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCAL1333
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCAL1333
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     BCAL1333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_C Acyl-CoA_dh_1 Acyl-CoA_dh_M AcylCoA_DH_N Acyl-CoA_dh_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: CAR51631
UniProt: B4E654
Position
1:1459644..1461473
Genome map
AA seq 609 aa AA seqDB search
MSLLMSRRDLAFLLYDWLDAEALVALPRYAEHSRETFDAVLDTSERIAEDLFAPHAARGD
RDEPRFDGERVTLIPEVEPAVRAFADAGLIAAGHDEALGGMRLPKLVEAASFLFFQAANI
ATAAYPFLTVANANLLVAHGSAAQIDAFARPELEGRFLGTMCLSEPQAGSSLSDIATRAD
FECDSPLGPRYRLTGNKMWISGGEHELAENIVHLVLAKIPDEHGRLQPGTRGISLFIVPK
FLTGADGDANGEHNDVVLAGLNHKMGYRGTTNCLLNFGEGTRYRPAGRAGAIGYLVGQPN
HGLAYMFHMMNEARIGVGAGAVALGYTGYLHALDYARNRPQGRPLGPAGKDAAAPQAPIV
DHPDVRRMLLAQKAYVEGGLALILYCAKLVDEARAHDDAAVRADAARLLDILTPIAKSWP
SQWCVAANDLAIQVHGGYGYTRDYAVERLYRDNRLNPIHEGTHGIQALDLLGRKVSQDDG
ASLRALDARIGATVERARALDAGMREQAEALARRWARLGDVTRQLSAIGDPQTRLANASV
YLEAFGHLVVAWLWLDVTLAAHGHDGDFHDGKRAGARYFFHWELPKVDAQLDLLSSVDTT
TLDMRDAWF
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgttgatgtcgcgacgcgatctcgcgttcctgctgtacgactggctcgacgcc
gaagcgctcgtcgcgctgccgcgttacgcggagcatagtcgcgagaccttcgacgcggtg
ctcgacaccagcgaacggatcgccgaagacctgttcgcgccgcatgcggcgcgcggcgat
cgcgacgagccgcggttcgacggcgaacgcgtgacgctgatcccggaagtcgaaccggcc
gtgcgcgcgttcgcggacgccgggctgatcgccgcagggcacgacgaagcgctcggcggc
atgcgcttgccgaagctggtcgaagccgcgtcgttcctgttcttccaggccgcgaacatc
gcgacggccgcgtatccgttcctgaccgtcgccaatgcgaacctgctcgtcgcgcacggc
agcgccgcgcagatcgatgcgttcgcgcgccccgagctggaagggcgtttcctcggcacg
atgtgcctgtcggagccgcaagccggctcgtcgctgtccgacatcgcgacgcgcgccgat
ttcgaatgcgattcgccgctcggcccgcgctaccggctgaccggcaacaagatgtggata
tccggcggcgagcacgagctggcggagaacatcgtccacctcgtgctcgcgaagattccc
gacgaacatggtcggttgcaacccggcacgcgcggcatctcgctgttcatcgtgccgaag
ttcctgacgggcgccgatggcgatgcgaacggcgagcacaacgacgtcgtgctcgccggg
ctgaaccacaagatgggctatcgcggcacgaccaactgcctgctgaatttcggcgaaggg
acgcgttaccgtccggcagggcgtgcgggcgcgatcggttatctggtcggccagccgaat
catgggctggcctacatgttccacatgatgaacgaggcgcgcatcggcgtcggcgcgggt
gcggtggcgctcggctacaccggttatctgcacgcgctcgactatgcgcgcaaccgtccg
caagggcgcccgctcgggccggccggcaaggatgcggccgcgccgcaggcgccgatcgtc
gatcatccggacgtgcggcgcatgctgctcgcgcagaaggcttacgtcgagggcgggctc
gcgttgatcctgtactgcgcgaaacttgtcgacgaagcgcgcgcgcacgacgatgcggcg
gtgcgcgccgatgccgcgcgcctgctcgacatcctgacgccgatcgcgaaaagctggccg
tcgcagtggtgcgttgccgcgaacgatctcgcgatccaggtgcacggcggttacggctat
acgcgcgactacgcggtcgaacggctctatcgcgacaaccgcctgaatccgattcacgaa
ggcacgcacggcatccaggcgctcgatctgctgggccgcaaggtgagccaggacgacggc
gcgtcgctgcgcgcgctcgatgcacggatcggcgcgaccgtcgagcgtgcgcgagcgctg
gatgccggcatgcgcgagcaggccgaggcattggcccggcgctgggcgcggctgggcgac
gtgacacgccagttgagcgcgatcggcgatccgcagacgcggctcgcgaacgcgagcgtg
tatctcgaagcgttcggccatctcgtcgtcgcctggctgtggctcgacgtgacgctcgcc
gcgcacgggcacgacggcgatttccacgacggcaagcgcgcgggggcccgctacttcttc
cactgggaactgccgaaggtggatgcacagctcgacctgctgtcgagcgtcgacacgacc
acgctcgacatgcgcgacgcgtggttctga

DBGET integrated database retrieval system