KEGG   Burkholderia cenocepacia J2315: BCAL1355
Entry
BCAL1355          CDS       T00771                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V
Other DBs
NCBI-ProteinID: CAR51653
UniProt: B4E676
Position
1:1484514..1487309
AA seq 931 aa
MSVITEFASLFGAFNRLYSLDGSGALAAFQIERWTGRESLSDLFEWNVDALSTDPALDLD
AMLGQRVAIRTTLANGTTTLRSGLVAEAECRGYDAGLARYHLRIVPWLAALAHARDERTF
VNQTLADVLDTVFAPYAGIARWRLTPDAGRRLDALGPTAYRVQYRTHTHYEFVQHLLAEA
GLGFCFVEDEDAPAGHTMLVFDDSAQLAEDDTSARRGGVPRRSSGTATGADDVILGIGQS
LSLTADRITLISSDYRVNRATTASTTLGRPAGARELYDDVGPEAFDSLREAEDTVRRQAD
AIVSRASFWTGYGTLRTARAGRALKLVDAGWQPVRGAAAPEDFLLTRVEHVGINNLPATV
MEAIERRLGPLPAAALDPRVVRQAQAGGYANRFDAVPRTQVWRPTLADGTGQRLNPVPTA
LGAQTAIVVGPAGDARPGSTGPVHADAQGRLRVRFHWQAQDDAGTYPTRAIQRLASDGHG
LQQLPRIGHEVLVQFHHGLIHRPIVLGGLFNGRGEGGESPSPGGAAGKPLDASIYTQAGD
HAPSAQGNLASGLSPAWHGAGGGTDRHNHAGALSGFKSQGFDGHGHNQLVADDSDGMGRL
QMATTHAATQLNLGHLRHQADNYLGSFRGQGVELRSDAYGAMRATRGLLVSSYAPAGAAQ
PAGDASALQALLARHTALVRRFDQTADTHGTLPFAARRGVEQAGQSSLNGSAAPLDALAQ
SFATTVGANGYTQASADAAQRSTGNALPHTGDAVLGIEARGGHGLVAGQALQWAAGETLS
LGSGGDFNLAAAQQLRIHSGQGIGWLAGASHAERVGIGMIAGKDGLTLQAQRDVLGLHAR
DDLTLASASADVEIAAKKTVHLAVSGGAHVTIEGGDVTFGCPGKFVVYAAQHAFVGPAQL
NTPLPQFPEKVCVECLLHAMQSGSALAGKAI
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgagcgtcatcacggaatttgcgtctctttttggcgcattcaatcgcctgtattcgctg
gacggatcgggcgcgcttgcggcatttcaaatcgagcgctggaccggccgcgaatcgctc
tccgatctctttgaatggaacgtcgatgcgctgtcgacggatcctgcactggatctcgac
gcgatgctcgggcagcgtgtcgcgattcgcaccacgctcgcgaacggcacgacgacgctg
cgcagcggtctcgtcgccgaggccgagtgcaggggctacgacgcaggcctcgctcgctac
catctccggatcgtgccgtggcttgccgcactcgcgcatgcgcgcgacgagcgaaccttt
gtgaaccagacgcttgccgacgtgctcgacacggtgttcgcgccgtacgccgggatcgcg
cggtggcgtctcacgccggatgctggccggcggctcgatgcgctgggccccactgcgtat
cgcgtgcagtaccgaacccatacgcactacgaattcgtgcagcatctgctggccgaggct
ggcctcgggttctgcttcgtcgaagacgaggacgcgcctgccgggcatacgatgctggtc
ttcgacgacagcgcgcaactggccgaggacgatacgtccgcgcgacgcggcggggtgccg
cgccgctcgagcgggacggcgaccggcgccgacgacgtgatcctcgggatcgggcagtcg
ctgtcgctgacggccgatcgcatcacactgatcagcagcgattatcgcgtgaaccgggcg
actaccgcgagtacgacgctcggccggccggcgggcgcgcgcgaactctacgacgacgtc
gggccggaggcgttcgacagcttgcgcgaagcggaagatacggtaaggcgccaggccgat
gcgatcgtgtcgcgcgccagtttctggaccggctacggcacgctgcgcacggcgcgcgca
ggacgcgcgctgaaactcgtcgatgccggctggcagcccgtgcgcggcgccgcggcgccc
gaggattttctgctgacgcgcgtcgagcacgtcgggatcaacaatctgccggcgaccgtc
atggaggccatcgaacggcgactcgggccgttgccggcggcggcgctcgatccgcgcgtg
gtccggcaagcgcaggccggcggttatgcaaaccggttcgatgcggtgccgcgaacgcag
gtctggcggcccacgctggccgacggaaccgggcagcgactcaatccggttccgacggca
ctgggtgcgcagacggcgatcgtcgtcgggccggccggcgacgcacggcccggttcgacg
gggcccgtgcacgccgatgcgcaggggcggttgcgcgttcgcttccactggcaggcgcaa
gacgatgcgggtacgtatccgacgcgcgccatacaacggctcgcgagcgacgggcacggc
cttcagcagctgccgcgcatcggtcatgaagtcctcgtgcagtttcaccatgggctgatc
caccggccgatcgtgctcggcggcctgttcaatggccgcggcgaaggcggcgagtcgcct
tcgccgggcggggcggccggcaagccgctcgacgcgtcgatctacacgcaggcgggcgat
catgcgccgagcgcgcagggcaatctggcaagcgggctgagccccgcgtggcatggcgcc
ggcggcggcaccgatcgtcacaatcacgccggcgcgctgtcgggcttcaagagccagggt
ttcgacgggcatggccacaaccagctcgtcgccgatgattcggacggcatgggacgcctg
cagatggcgactacgcacgcggccacgcaactgaacctcggtcatctgcgccatcaggcg
gacaactatctcggcagttttcgtggccagggcgtcgaattgcgctcggatgcgtacggt
gcaatgcgtgcgacgcgcggcctgctggtgtcgagctacgcgcctgccggcgccgcccag
ccggcgggcgatgcgtccgcgctgcaggcgctgctcgcgcggcacaccgcattggttcgg
cgattcgaccagacggccgatacgcatgggacgctgccgttcgccgcacggcgcggcgtg
gagcaggcgggccagtcgtcgttgaacggcagcgccgcgccgctggatgcgcttgcgcag
agcttcgcgacgacggtcggcgcgaacggctacacgcaggcgtcggccgacgccgcccag
cggtcgaccggcaacgcactgccgcacacgggcgacgccgtgctcggcatcgaggcacgg
ggcgggcacgggctggttgccggccaggccctgcaatgggcggccggcgaaacgctgtcg
ctcggcagcggtggcgacttcaatctcgccgctgcgcagcagctgcgcattcacagcggg
caaggcatcggctggctggccggcgcgagccatgcggagcgtgtcggcatcggcatgatc
gccggcaaggacggactgacgctgcaggcgcagcgcgatgtgctgggcctgcacgcgcgc
gacgatctgacgctcgcgtccgcgagcgcggacgtcgagatcgccgcgaagaagaccgtg
catctcgcggtgagcggaggggcgcacgtgacgatcgaaggtggcgacgtcacgttcggt
tgcccgggcaaattcgtcgtgtatgccgcgcagcatgcattcgtggggcccgctcaactg
aatacgccgttgccgcagtttcccgaaaaggtctgtgtcgaatgcctgctgcacgcgatg
cagtcgggcagcgcactcgcgggcaaggcgatctga

DBGET integrated database retrieval system