KEGG   Burkholderia cenocepacia J2315: BCAL1358
Entry
BCAL1358          CDS       T00771                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB
Motif
Pfam: DUF2235
Other DBs
NCBI-ProteinID: CAR51656
UniProt: B4E679
Position
1:1488856..1491255
AA seq 799 aa
MSFRFASADRPDVGVVTREEQDAIMRRLHDDDGMSCCKTLHVGIFFDGTRNNADRDRTGG
KHSNVARLFDVFPRDKYHSAIYVAGVGTPFVDEIGDQGVGLQAAAGAATGWAGEGRINWA
LLQIHNVVHAHAFGNSLSAALGKSDKELAKAVSVDLNFKGIDLGGTPPKPGSLGDINARG
SSSVGALKLMAAEQNGIELTWDRDTIWAQLKGEVDTANWTATMRAWDEKRRVALRARCAQ
LKVRVGDLLVKGKPKLQRIRLYVFGFSRGAAEARTFSNWLADALDPDFSLCGVPVSYDFL
GIFDTVASVGIAQSTAATLFDGHGGWGRKELMGVPRYVRRCVHMVAAHEPRGSFPLDLID
ASRDGHEEIVYPGVHSDVGGGYGPGEQGRGTGDADKLSQVPLLDMYREARKAGVPLDIKG
PGVAAEAAAAFAISPALKRAFSAYVSTSADYYYAKEHGTPGLMRAHYGLYLRWRKMRLDN
LRSQPSFLAAKAAYPQDAVDLDSANEELRLEWRDLLECEKEGGPTVSRYAGNTVSRKITQ
NPKAAAVISPAVLPIAAGLQSAIPFVGPLVRASAKRAEDFFQLQLEEKWKQWLEVRGDWN
MGPPEAPISALYDNFMHDSRAWFKPLGDDDDVWNHNQIKALKTRQAEFERKHAEWKKRQQ
LGVPGPSQIMQMMGAGALGLGPAANVAPEPEPRSPLTAQQAGILKRYDAAQQAAQKARAA
RDATAPTDSAVLTDPKVTGGLALQDSGREFSFVWGYLRWRTVYVNGVRWDAPHVPSVQED
MEAMRQQMQRNVDMSKLFR
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgagtttccgcttcgcgagcgccgaccggcctgacgtcggcgtcgtcacccgggaggag
caggacgcgatcatgcgtcggctgcacgacgacgacgggatgagttgctgcaagacgctg
catgtcggcatcttcttcgacggcacgcgcaacaacgccgatcgcgatcgcacgggcggc
aagcacagcaacgtcgcgcggctgttcgacgtgtttccgcgcgacaagtatcacagtgcc
atttacgtggccggcgtcggcacgccgttcgtcgacgagatcggcgaccagggcgtcgga
ctgcaggccgcggccggcgcggcgacgggatgggccggcgaggggcgcatcaactgggcg
ctgctgcagatccacaacgtcgtgcatgcgcacgcgttcggcaattcgctgtccgcggcg
ctcggcaagagcgacaaggaactcgcgaaggccgtcagcgtcgacctgaatttcaagggc
atcgatctcggcggcactccgcccaagccgggcagtctcggcgacatcaacgcgcgcggc
agttcgagcgtcggtgcgctcaagctgatggccgccgagcagaacgggatcgaactgacc
tgggatcgcgacacgatctgggcgcagctcaagggcgaagtcgatacggcgaactggacc
gcgacgatgcgcgcatgggacgagaaacgccgcgtcgcattgcgggcccggtgcgcgcag
ctgaaggtgcgcgtcggcgatctgctggtgaagggcaagccgaaactgcagcgcattcgg
ctgtacgtgttcggtttttcgcgcggggcggccgaggcccgcacgttctcgaactggctg
gccgatgcgctggaccccgatttcagcctgtgcggcgtgcccgtgtcttacgactttctc
ggcatcttcgatacggtcgcgtcggtcggcatcgcgcaaagcacggccgcgacgctgttc
gacgggcacggcggctgggggcgcaaggaactgatgggcgtgccgcgctacgtgcgccgc
tgcgtccatatggtcgccgcccacgagccgcgcggatcgttcccgctcgacctgatcgat
gcgtcgcgggacgggcatgaggaaatcgtctatccgggcgtgcattcggatgtcggcggc
ggttacgggccaggcgagcaggggcgcggcaccggcgacgcggacaagctgtcgcaggtg
ccgctgctcgacatgtatcgcgaagcgcgcaaggccggtgttccactcgatatcaagggg
cccggtgtcgctgccgaagccgcggcggcattcgcgatttctcccgcgctcaagcgcgcc
ttttccgcctatgtgagcacgagcgccgactattactacgcgaaggagcacggcacgccg
ggcctgatgcgcgcgcactacgggctttacctgcgctggcgcaagatgcggctcgacaat
ttgcgttcgcaaccgtcgtttctcgccgccaaggctgcctatccgcaggatgccgtcgat
ctcgacagcgcgaacgaggaactgcggcttgaatggcgcgacctgctcgaatgcgagaaa
gaaggcggaccgaccgtgagccggtacgcgggcaacacggtcagccggaagatcacccag
aacccgaaggcggcggccgtcatttcgccggccgtcctgccgatcgccgcgggcctgcag
tccgcgattccgttcgtgggcccgctcgtgcgcgcgagcgccaagcgcgccgaggatttc
ttccagctgcagctcgaagagaaatggaagcagtggctcgaggtgcgcggcgactggaac
atggggccgccggaagcgccgatcagcgcgctgtacgacaacttcatgcatgactcgcgc
gcatggttcaagccgctgggcgacgacgacgacgtgtggaaccacaaccagatcaaagcg
ctgaaaacgcgccaggccgagttcgagcgcaagcacgccgagtggaagaagcgccagcaa
cttggcgtgccgggaccgtcgcagatcatgcagatgatgggggcgggtgcgctcgggctc
gggccggccgccaacgtcgcgccggagcccgaaccgcgttcgccgctgaccgcgcagcag
gccggcatcctgaaacgttacgacgccgcgcagcaggctgcacagaaagcccgcgcggcc
cgggatgccaccgcgccgaccgacagcgccgtgctgaccgacccgaaagtcaccggtggt
ctcgcgctgcaggattcggggcgcgagttttcgttcgtctggggctacctgcgctggcgc
accgtctacgtgaacggcgtgcgctgggacgcgccccatgtgccgagcgtgcaggaagac
atggaggcgatgcgtcagcagatgcagcgcaacgtcgacatgagcaagctgttccgatga

DBGET integrated database retrieval system