KEGG   Burkholderia cenocepacia J2315: BCAL1359
Entry
BCAL1359          CDS       T00771                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BCAL1359
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcj02044]
    BCAL1359
Secretion system [BR:bcj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BCAL1359
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V
Other DBs
NCBI-ProteinID: CAR51657
UniProt: B4E680
Position
1:1491317..1495018
AA seq 1233 aa
MDLVAALTGYGQATRHIQIDTAMPDAFVVERFHGREGISESFRFEIDVLSSEPFLDLAPL
IGSAVRLRLATAAGERCWNGYVTHAAYAESDGEFTRYRLTMESWLALLKLRRNCLYFVDL
DAEGICERVFGDYPEAHWRYELVEPLRSFRLRGQYRETDLDFVSRQLSEAGLSFRIEHGQ
DAGKAPSGDHTVVVFDRHARLPDGSAIAFNAQDVGDPDGVMTQFSDRRQLVPDRVVATSW
KASELHALAGHAQQPADADAPLLPVREIYDGQRAGRFDTSGDAQRYAEQRLDALQLAKRV
YRGGGSSRTLETGKVHTLNDYLGGTVRFVPLSIEHEAVNNLGAQIGQLFGRGELDKGLYR
NRFVAVPEGTPIVPPFRDRPTVYGVQTAIVVGEPGGRVSSTRDHQVRIQFPWMRGVAPLP
GGLTDTASRSNPTGHAPGDHRSGILVRVAEQAAGPNFGHAFVPRVGAEVVVGFESGNIDA
PVVLGQVYGGRVRPPFSAGEGSDANHSGTLTGLQTQTLDGQPGSRWVMDDAAGQLRHELS
NSTADTRLAQGYLIDQQGTMRGAYRGEGFELATQGWGVVRAGAGVLMSSTARRLGVSTQM
DVAERVEQLKGAAKTAQELDTAATGAQAAGLSANKAQTDFLKAIDPAQDGKYAGSVGGQS
ATKPTGTQRDGGDPVERFATPVVLMESPENIVVTTPESAVSYAAQHVHLTSQGDAHVGAG
ATVAAATGDAMSLYSVAGGLKAIAGEGPVSVEAHASTMEILADQTVRVTSTDERVDVLAQ
DAIVLQQGPNRITLKGGDIVVETPGQFAVKAGGHPFPGPRATSVKLPALPVLPQGDPCDF
LVQALAASPAGRGAVAGGGSLVGAASSIVGATLPTASGAMGAAQAFSRAPGQPLPAPSAA
APTAAERGSGPSLGYSTPPPVSSELEGMPKKGAAAHSGPCNLHVPAIKKEEHTVSMGAAD
YYETDEGGNPKLKNGQLNWLQYAASTGTYDIGYAPATATLTATVRIKVHLKDQHWINQGR
VHMDPATGKPFSVPYNSDGIRQGLIIRVVDRPGGLAAVSGFKKRIEEGLNRGNYSMQPKA
CPLGKACTCKVKVKLEVELVQTGRCHAEINLFPKVTRANSENWGEVQVEWNPQQQRFVPV
STQNAIAHESGHLFGWPDEYFVDGGAVFGKYINSRHLVDVTMAQLDDNWQRTTETNLMGR
GMYTQKPEIPKYYMYGFRDWFNEKTGIDWEVLK
NT seq 3702 nt   +upstreamnt  +downstreamnt
atggatctagttgccgcattaacggggtacgggcaagcgacccgtcatatccagatcgat
accgcgatgccggacgcattcgtcgtagagcgctttcacggtcgtgaagggatcagcgaa
tcgttccggttcgagatcgacgtgctgtcgagcgagccgtttctcgatctcgcgccgctg
atcggcagcgccgtgcggctgcgtctcgcgacggcggcgggcgaacgatgctggaacggc
tacgtcacgcatgccgcttatgcggagagcgacggcgagttcacgcgctatcggctcacg
atggaatcgtggctcgcgctgctgaagctgcgccgcaattgcctctatttcgtcgacctc
gacgccgaggggatctgcgagcgtgtgttcggcgactatccggaagcgcactggcgctat
gaactcgtcgagccgctgcgatcgtttcgcttgcgcggccagtatcgcgaaaccgatctc
gatttcgtgtcgcggcagttgtccgaggccgggttgtcgtttcgcatcgagcacgggcaa
gacgcggggaaggcgccgtcgggcgaccataccgtcgttgtgttcgaccgccatgcgcgg
ctgcccgacggcagcgccatcgcattcaatgcgcaggacgtcggcgatccggacggcgtg
atgacgcaattctccgatcggcgtcagctggtgccggatcgcgtggtggcgacgagctgg
aaagccagcgaacttcatgcgcttgccggccatgcgcaacagcccgccgatgccgacgcg
ccgttgctgccggtgcgggagatctacgacggccagcgcgcaggccgcttcgacacgagc
ggcgatgcgcagcgttacgccgaacagcgtctcgacgcgctgcagctcgcgaaacgggtc
taccgtggcggcgggtcgtcgcgcacgctcgaaaccggcaaggtccatacgctgaacgac
tatctgggcggcaccgtgcgattcgtaccgctgtcgatcgagcacgaggccgtcaacaac
ctcggcgcgcagatcggccagctgttcggacgcggcgagctcgacaaggggctgtatcgc
aaccgcttcgtcgcggtgccggagggcacgccgatcgtgccgccgttccgcgaccggccg
acggtgtacggggtgcagactgcgatcgtcgtcggcgagccgggtgggcgcgtcagcagc
acgcgcgatcaccaggtccgcatccagtttccgtggatgcgcggtgtcgcgccgctgccg
ggcgggttgacggatacggcaagccggtccaatccgaccggccacgcgccgggcgatcac
cgttcgggcattctggttcgcgtcgccgaacaggcggccgggccgaatttcggtcatgcg
tttgtaccgcgcgtgggggcggaagtggtggtcggcttcgagtcgggcaacatcgatgcg
ccggtcgtgctcggccaggtgtacggcgggcgtgtgcgtccgccgttctccgcgggcgaa
ggcagcgacgcgaatcattcaggaacactgacgggcctgcagacgcaaaccctcgatggg
caacccggcagtcgctgggtgatggacgatgcggccggacaactgcgtcacgagctgagc
aattcgaccgccgacacgcgcctcgcgcagggctatctgatcgaccagcaggggacgatg
cgcggcgcctatcgcggtgaaggcttcgaactggcgacgcagggatggggtgtcgtgcgg
gccggcgcgggcgtgctgatgtcgagtaccgcgcgccggctcggcgtgtcgacgcagatg
gatgtcgccgaacgcgtggagcaattgaagggcgcggcgaaaacggcgcaggaactcgac
acggcggcgaccggtgcgcaggcggccggcctgagcgcgaacaaggcgcagactgatttc
ctcaaggcgattgatcctgcgcaggacggcaagtacgcgggcagcgtgggtggtcagagc
gcgaccaagccgaccgggacgcagcgcgacggcggcgatcccgtcgagcgattcgcgacg
cccgtggtgctgatggagtcgccggagaacatcgtggtgacgacgccggagagtgcggtg
tcgtatgcggcgcagcacgttcatctgacgtcgcaaggcgatgcgcatgtgggcgccggt
gccaccgtggccgcggcgacgggcgatgcgatgagcttgtacagcgtggcgggcgggctc
aaggcaatcgcgggcgaagggccggtgagcgtcgaggcgcatgcgtcgacgatggagatt
ctcgcggaccagaccgtgcgcgtgacgtcgaccgacgagcgcgtcgacgtgctcgcgcag
gacgcgatcgtgctgcagcaggggccgaaccggatcacgttgaagggtggcgatatcgtc
gtcgagacgccggggcaattcgcggtgaaggcgggcgggcatccgttcccggggccgcgg
gcgacgagcgtgaagctgccggcgctgccggtgttgccgcaaggcgatccgtgcgacttt
ctcgtgcaggcgctggcggcgagtccggcggggagaggggcggtggcagggggcggaagt
ttggtgggtgcggcgagttcgatcgtcggtgcgacgctaccgacagcgagcggtgccatg
ggcgcggcgcaggcattttcccgtgcgcccggtcaaccgctgcccgcgccttccgcggct
gcacccacggcggcggagaggggatccggtccctctctcggttattcgacgccaccaccc
gtgtccagtgagctggagggcatgccgaaaaaaggtgcggctgcgcacagtggaccgtgc
aaccttcacgtccccgcgatcaagaaggaagagcataccgtcagtatgggggccgccgac
tattatgagacggatgagggcggcaatccgaagttgaagaatgggcaactcaactggctt
caatatgcggcatcgaccgggacgtacgatatcggctatgcacctgcgacggcgacgttg
acggcaaccgtccgtatcaaggttcatctgaaggatcaacactggatcaaccaggggcgc
gtccatatggatccggcgacgggcaagccgttttcggtgccgtacaacagcgatggcata
cggcaaggcttgatcatcagggtagtggaccgacccggtggtcttgctgccgtgtcgggc
ttcaagaagcgcatcgaggaaggactgaaccgggggaattactcgatgcagccgaaggcg
tgtccgctcggcaaggcatgtacatgcaaggtcaaggtgaaacttgaagtcgaactcgtt
caaaccgggagatgccatgccgagatcaatctctttcccaaggtgacgcgagcgaactcg
gagaattggggggaagtgcaagtcgagtggaacccgcagcagcaacggtttgtcccggta
tcgacccagaatgcgatcgcgcatgagagcgggcacttgttcgggtggccggatgagtac
tttgttgacggcggcgccgtgttcgggaagtacatcaactcgcgacatctggtcgacgtg
acgatggcacagctcgacgacaactggcagcgcaccaccgaaacgaacttgatgggccgc
ggaatgtacacgcaaaagccggaaattccgaagtactacatgtacggcttccgtgactgg
ttcaacgaaaagaccggaattgactgggaagtgctgaaatga

DBGET integrated database retrieval system