KEGG   Burkholderia cenocepacia J2315: BCAL1894Help
Entry
BCAL1894          CDS       T00771                                 

Definition
(GenBank) putative L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bcj  Burkholderia cenocepacia J2315
Brite
Enzymes [BR:bcj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BCAL1894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 NodS Methyltransf_31 Methyltransf_11 RrnaAD Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: CAR52194
UniProt: B4EAX9
Position
1:complement(2090365..2091297)
Genome map
AA seq 310 aa AA seqDB search
MSGERAKRFPLALEDLKRAPRKSDGRAGERQAAGAVPKAADKPAAVLKPVAVKPAAVRAP
LPGIGAAKPATAPKPTVLKPALPKPAAPTIAPAGAFALTSERVRERMVERLRANGVTDTR
VLDAMAAVPRHLFVDPGLATQAYEDSALPIGHQQTISKPSVVARMIELAMAGRTLERVLE
IGTGCGYQAAVLSHVARDVYSIERIKPLYERAKLNLRPLRVPNIRLHYGDGRVGLPSAAP
FDAIVIAAAGLDVPQALLEQLAIGGRLVAPVGAQSGQHQVLTLVERVAHAQWRESRLDRV
FFVPLKSGVI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcgcgcgaagcggttcccgctcgcgctcgaagatctcaagcgagcgcca
cgcaagtcggacggtcgggccggtgaacgccaggcggcgggcgcggtgccgaaggccgcc
gacaaacccgcagccgtgctgaaaccggttgcggtgaagccggccgccgtgcgggcgccg
ctgccgggtatcggcgccgcgaaaccggcgaccgcgccgaagccgaccgtgctcaagcca
gcgctgccgaagccggctgcgcccacgatcgcgccggccggcgcgttcgccctcacgtcg
gaacgtgtgcgcgagcggatggtcgaacgcctgcgcgcgaacggcgtgaccgatacgcgc
gtgctggacgcgatggccgcggtgccgcgccacctgttcgtagatccggggctcgcgacg
caggcctacgaggattcggcgctgccgatcggccatcagcaaaccatttcaaagccgtcg
gtcgtcgcgcgcatgatcgagctcgcgatggccggccgcacactcgagcgcgtgctcgag
atcggcacgggctgcggctatcaggccgccgtgctgagccacgtggcacgcgacgtgtat
tcgattgaacgcatcaagccgctgtatgagcgcgcgaagctgaacctgcggccgctgcgc
gtgccgaacatccgtctgcactatggcgacgggcgtgtcggcctgccgtccgcggccccg
ttcgacgcgatcgtgatcgcggcggcggggctcgacgtgccgcaggcgctgctcgagcag
ctcgcgatcggcgggcggctcgtcgcgccggtcggcgcgcagagcgggcagcaccaggtg
ctcacgctcgtcgagcgcgtcgcgcacgcgcaatggcgagagtcccggcttgatcgcgtt
ttctttgtccctttaaaatccggagtgatttga

DBGET integrated database retrieval system