KEGG   Burkholderia cenocepacia J2315: BCAL1897Help
Entry
BCAL1897          CDS       T00771                                 

Gene name
recR
Definition
(GenBank) recombination protein
  KO
K06187  recombination protein RecR
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCAL1897 (recR)
DNA repair and recombination proteins [BR:bcj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BCAL1897 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BCAL1897 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH zf-RING_9
Motif
Other DBs
NCBI-ProteinID: CAR52197
UniProt: B4EAY2
Position
1:complement(2093531..2094127)
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRVLPGVGPKSAQRMAVHLMQHDREGAERLGRSLLFATEHLQHCEKC
NTFTEAQICEVCSDEERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGVVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRTM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagccgtccgccctgtccgccctcgtcgaagcgttgcgcgtgctgcccggcgtc
gggccgaaatccgcgcagcgcatggcggttcacctgatgcagcacgaccgtgagggcgcg
gagcggctcggccggtcgctgctgttcgcgaccgagcacctgcagcactgcgagaagtgc
aacacgttcaccgaagcgcagatctgcgaggtctgcagcgacgaggagcgtgatccgacg
ctgctgtgcgtcgtcgagacgcctgccgaccagatcatgctcgagcagacgatgacctac
cgcgggttgtatttcgtgctgatggggcgactgagcccgctcgacgggatcggcccgaag
gaaatccatttcgaccgcctcgtgcggcgcgcgtccgacggcgtcgtcaaggaagtcgtg
ctcgcgaccaacttcacgaacgaaggcgaagccaccgcccactacctcggccagacgctc
aaggcgcgcgggctggcggtcacgcgcctcgcgcgcggcgtgccggtgggcggcgagctc
gagtacgtcgacgcgggcaccatcgcccgcgcgatgctcgaccgccgcacgatgtaa

DBGET integrated database retrieval system