KEGG   Burkholderia cenocepacia J2315: BCAL1977Help
Entry
BCAL1977          CDS       T00771                                 

Definition
(GenBank) putative thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00071  Fatty acid degradation
bcj00072  Synthesis and degradation of ketone bodies
bcj00280  Valine, leucine and isoleucine degradation
bcj00310  Lysine degradation
bcj00362  Benzoate degradation
bcj00380  Tryptophan metabolism
bcj00620  Pyruvate metabolism
bcj00630  Glyoxylate and dicarboxylate metabolism
bcj00640  Propanoate metabolism
bcj00650  Butanoate metabolism
bcj00900  Terpenoid backbone biosynthesis
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01200  Carbon metabolism
bcj01212  Fatty acid metabolism
bcj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAL1977
   00630 Glyoxylate and dicarboxylate metabolism
    BCAL1977
   00640 Propanoate metabolism
    BCAL1977
   00650 Butanoate metabolism
    BCAL1977
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCAL1977
   00072 Synthesis and degradation of ketone bodies
    BCAL1977
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCAL1977
   00310 Lysine degradation
    BCAL1977
   00380 Tryptophan metabolism
    BCAL1977
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCAL1977
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCAL1977
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCAL1977
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcj04147]
    BCAL1977
Enzymes [BR:bcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCAL1977
Exosome [BR:bcj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCAL1977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAR52277
UniProt: B4EBK4
Position
1:complement(2175106..2176284)
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTPLAKSWRGAFNMTHGATLGGHVVAAALERAKLDPARVEDVIMGCANPE
GATGANIARQIALRAGLPVSVPGMTVNRFCSSGLQTIALAAQRIIAGEGEIYVAGGVESI
SCVQNEMNRHMIQEGWLVQHKPEIYWNMLQTAENVAKRYGISKERQDAYGVQSQLRAAAA
QEAGLFLDEIVPITVLAGIADKATGRLFTQEVTVSADEGIRPDTTLEGVSKIRSAVPGGV
ITAGNASQFSDGASACVVMSAEAAQREGLQPLGAFRGFAVAGCEPDEMGIGPVFAVPKLL
KQAGLKVDDIGLWELNEAFAVQVLYCRDTLGIPEDRLNVNGGAIAVGHPYGVSGARLTGH
ALIEGKRRGVKYVVVTMCIGGGQGAAGLFEIL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtaatcgtatcgaccgcacgcacgccgctggcgaaatcctggcgcggt
gcattcaacatgacgcacggcgcgacgctcggcggccacgtggtcgcggccgcgctcgag
cgcgcgaagctcgaccccgcccgcgtcgaggacgtgatcatgggctgcgcgaaccccgaa
ggcgcgacgggcgcgaacatcgcgcggcagatcgcgttgcgcgccggcttgccggtgagc
gtgccggggatgacggtgaaccgcttctgttcgtcagggctgcagaccatcgcgctggcc
gcgcagcggatcatcgcgggcgaaggcgagatctatgtggccggcggcgtcgagtcgatc
tcgtgcgtgcagaacgagatgaaccggcacatgatccaggaaggctggctcgtccagcac
aagcccgagatctactggaacatgctgcagaccgccgagaacgtcgcgaagcgctacggc
atctcgaaggagcggcaggacgcgtacggcgtgcagtcgcaactgcgcgcggcggccgcg
caggaagccgggctgttcctcgacgagatcgtaccgatcaccgtgctcgcgggcatcgcc
gacaaggcgacgggccgcctgttcacgcaggaagtgacggtgtcggccgacgaaggcatc
cggcccgacacgacgctcgaaggcgtgtcgaagatccgttcggcggtgccgggcggcgtg
atcaccgcgggcaacgcgagccagttctcggacggcgcgtcggcgtgcgtcgtgatgagc
gccgaggccgcgcagcgcgaagggctgcagccgctgggtgcgttccgcggcttcgcggtg
gccggctgcgaaccggacgaaatgggcatcggcccggtgttcgcggtgcccaagctcctg
aagcaggcggggctgaaggtcgacgacatcggcctgtgggagctgaacgaggcgttcgcg
gtgcaggtgctgtattgccgcgacacgctcgggatccctgaggatcgcctgaacgtgaac
ggcggcgcgatcgcggtcggccacccgtacggcgtgtcgggcgcacgcctgacgggccat
gcgctgatcgaaggcaagcggcgcggcgtcaagtacgtggtcgtcacgatgtgcatcggc
ggcgggcagggcgcggccggcctgttcgaaatcctctga

DBGET integrated database retrieval system