KEGG   Burkholderia cenocepacia J2315: BCAL2042Help
Entry
BCAL2042          CDS       T00771                                 

Definition
(GenBank) putative transport-related membrane protein
  KO
K03457  nucleobase:cation symporter-1, NCS1 family
Organism
bcj  Burkholderia cenocepacia J2315
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BCAL2042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transp_cyt_pur
Motif
Other DBs
NCBI-ProteinID: CAR52342
UniProt: B4EC49
Position
1:complement(2250949..2252541)
Genome map
AA seq 530 aa AA seqDB search
MRARGVCRGPLVRLRATIRSDIDDGGAAFRPRQGEVMAQFSVAHDSAYPAEEGGEGGGPA
LPDGYSERLYNEDLAPLKNQTWGSYNIFAFWMSDVHSVGGYVFAGSLFALGLTSWQVLIA
LIVGIGLVNALCNLIARPSQQIGVPYPVACRATFGVLGANVPAVIRGLIAIAWYGIQTYL
ASSALVIVVLKFFPQWLPYADVHRYGFLGLSAVGWAGFMLLWVLQAFVFWNGMETIKKFI
DFAGPAVYVVMFILAGYMVWRAGWRNIGINLGGVKYHGAEVIPVMITAVSLVVSYFSGPM
LNFGDFSRYCRSFGEVKRGNFWGLPVNFLAFSLVTVITTAATLPVFGELITDPVETVGRI
DHPTAVILGALTFTIATIGINIVANFVSPAFDFSNVAPRLISWRAGGMLAAVASIFITPW
NLFNNPAVIHYTLDVLGAFIGPLYGVLIADFYLVKRGRLVRDDLYTMSESGSYWYTGGVN
RRALAALLPAAVIAVACVMVPGWQGVANFSWFIGAGLGFVFYRLLVSAKA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcccgcggtgtttgccgcgggccgctggtccgactccgggcgacgatccggagc
gatatcgatgacggtggagcggccttccggccgcgtcaaggagaagtcatggctcagttc
agtgtggcgcacgacagcgcctatccggcggaagaaggcggcgagggcggcggtccggcg
ttgcctgatggttacagcgaacgtctgtacaacgaagatttggcaccccttaaaaatcag
acatggggctcgtacaacatcttcgcgttctggatgtcggacgtgcacagcgtcggcggc
tacgtgttcgcgggcagcctgttcgcgctcgggctgacgagctggcaggtgctgatcgcg
ctgatcgtcggcatcggcctcgtgaacgcgctgtgcaacctgatcgcgcggccgagccag
cagatcggcgtgccgtatccggtcgcatgccgcgcgacgttcggcgtgctcggcgcgaac
gtgccggccgtgatccgcgggctgatcgcgatcgcgtggtacggcatccagacttatctt
gcgtcgagcgcgctcgtgatcgtcgtgctgaaattcttcccgcaatggctgccgtatgcg
gacgtccatcgctacggcttcctcgggctgtcggcggtcggctgggccggcttcatgctg
ttgtgggtgctgcaggcgttcgtgttctggaacgggatggagacgatcaagaagttcatc
gacttcgcgggcccggccgtctatgtcgtgatgttcatcctggccggctacatggtgtgg
cgcgcaggctggcgcaacatcggcatcaacctcggcggcgtcaagtatcacggcgcggaa
gtgattccggtgatgattaccgccgtgtcgctcgtcgtgtcgtacttctccgggccgatg
ctgaacttcggcgatttctcgcgctactgccgctcgttcggcgaagtgaagcgcggcaat
ttctgggggctgccggtcaacttcctcgcgttctcgctggtcacggtgatcacgacggcc
gcgacgctgccggtgttcggcgaactgatcaccgacccggtcgagacggtcggccgcatc
gatcatccgaccgcggtgatcctcggcgcgctgacgttcacgatcgcgacgatcggcatc
aacatcgtcgcgaacttcgtgtcgcccgcgttcgatttctcgaacgtcgcgccgcgcctg
atcagttggcgcgcgggcgggatgctcgcggccgtcgcgtcgatcttcatcacgccgtgg
aacctgttcaacaacccggccgtgatccactacacgctcgacgtgctcggcgcgttcatc
ggcccgctgtacggcgtgctgatcgccgacttctacctcgtcaagcgcggccgcctcgtg
cgcgacgacctgtacacgatgtcggaaagcggcagctactggtacacgggcggcgtgaac
cgccgcgcgctcgccgcgctgttgccggccgcggtgatcgcggtggcctgcgtgatggtg
ccgggctggcagggtgtcgcgaatttctcgtggttcatcggcgcggggctcggcttcgtg
ttctaccggctgctcgtgagcgcgaaggcgtaa

DBGET integrated database retrieval system