KEGG   Burkholderia cenocepacia J2315: BCAL2122Help
Entry
BCAL2122          CDS       T00771                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00620  Pyruvate metabolism
bcj00630  Glyoxylate and dicarboxylate metabolism
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01200  Carbon metabolism
Module
bcj_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAL2122 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BCAL2122 (aceB)
Enzymes [BR:bcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BCAL2122 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CAR52423
UniProt: B4ECR3
Position
1:2338632..2340224
Genome map
AA seq 530 aa AA seqDB search
MSTPITLPQGMTITGEIKPGYEAILTPDALALVAALHRTFEPRRQALLQARVERTKRLDA
GERPDFLAETKAIREGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYKLNDKVATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALFLFHNAKELLARGSGPYFYLPKMESHLEARLWNDIFVAAQEAVGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRSKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANDKAMGGVRSDKQRDATDG
YDGGWVAHPGLVPIAMEEFVKVLGDKPNQIAKQRDDVQVEGKNLLDFQPEAPITEAGLRN
NINVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLDDGRKVTAELV
REFAKIELDNVKRAVGGNTQPYERAAAIFEQMSTSEGFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgatcacgctgccgcaaggcatgacgatcaccggcgaaatcaagccgggt
tacgaagccatcctgacgcccgacgcgctggcactcgtcgcggcgctgcaccgcacgttc
gagccgcgccgccaggcgctgctgcaggcgcgcgtcgagcggacgaaacgcctcgacgca
ggcgagcgccccgacttcctggccgagacgaaggcgattcgcgaaggcgactggaaggtc
gcgccgctgccggccgacctgcaatgccgccgggtcgagatcacgggccccgtcgagcgc
aagatgatcatcaacgcgctgaactcgggcgccgattcgtacatgacggacttcgaggat
tcgaacgcgccgagctggacgaaccagatcgacggccagatcaacctgaaggacgcggtc
cgccgcacgatctcgctcgaacagaacggcaagtcgtacaagctgaacgacaaggtcgcg
acgctgatcgtgcgtccgcgcggctggcacctcgacgaaaagcacgtgacggtcgacggc
cagcgcgtgtccggcggcatcttcgatttcgcgctgttcctgttccacaacgcgaaggaa
ctgctcgcgcgcgggtcgggcccgtacttctacctgccgaagatggaaagccatctcgag
gcgcgcctgtggaacgacatcttcgtcgccgcgcaggaagcggtcggcgtgccgcgcggc
acgatccgcgcgacggtgctgatcgagacgatcctcgccgcgttcgagatggacgagatc
ctgtacgaactgcgcgaacacagctcgggcctgaacgccggccgctgggactacatcttc
tcggcgatcaagaagttcaagaacgaccgcgacttctgcctggccgaccgctcgaagatc
acgatgacggtgccgttcatgcgggcgtacgcgctgctgctgctgaagacctgccacaag
cgcaacgcgccggcgatcggcgggatgagcgcgctgatcccgatcaagaacgatccggaa
gcgaacgacaaggcgatgggcggcgtgcgctcggacaagcagcgcgacgcgaccgacggc
tacgacggcggctgggtcgcgcacccgggcctcgtgccgatcgcgatggaagagttcgtc
aaggtgctcggcgacaagccgaaccagatcgcgaagcagcgcgacgacgtgcaggtcgaa
ggcaagaacctgctcgacttccagccggaagcgccgatcaccgaagccggcctgcgcaac
aacatcaacgtcgggattcactacctcggcgcatggctcgacggcaacggctgcgtgccg
atccacaacctgatggaagatgcggcgacggccgagatttcccgctcgcaggtgtggcag
tggatccgctcgccgaagggcgtgctcgacgacggccgcaaggtcacggccgaactcgtg
cgtgaattcgcgaagatcgagctcgacaacgtgaagcgcgcggtcggcggcaacacgcag
ccgtacgaacgcgccgcggcgatcttcgagcagatgtcgacgtcggaaggcttcaccgaa
ttcctgacgctgccgctgtacgaggaaatctga

DBGET integrated database retrieval system