KEGG   Burkholderia cenocepacia J2315: BCAL2619Help
Entry
BCAL2619          CDS       T00771                                 

Definition
(GenBank) glycosyl hydrolase family protein
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00460  Cyanoamino acid metabolism
bcj00500  Starch and sucrose metabolism
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BCAL2619
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BCAL2619
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     BCAL2619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like DUF11
Motif
Other DBs
NCBI-ProteinID: CAR52921
UniProt: B4E8B3
Position
1:complement(2877860..2880106)
Genome map
AA seq 748 aa AA seqDB search
MKTSLFRCSTIASACALTVLLASCGGDDIHAPTDPDAAADQRAAALVAQLTTDEKLQLVH
GTGMPALSLGGPFPADALNGASYIPGVPRLGIPAVSSADSAGGVNVKNARVTALPAPVAL
AATWDPALAGTYGTRIALELRALGFAEGLGGGVNLAREPRNGRTFEYMGEDPVLAGTLSA
ARTQATQAQKVIATIKHFAFNDQETNRMTVDSVVDERTMREAELLAFEIGVKDGQPGNVM
CAYNKLNGVYACENPYLLTTVLKNEWGFKGVVQSDWGATHSTVAAVQAGLDEEQPGAADD
GNAPLGSYFNSKLRAALQAGSVSVARLNDMVQRKLRTLIRIGVMDAPPKPGGAIDEAAGN
ADALAIARQAAVLLKNAAAPGDTQPVLPLAAGTLKSVVVIGGHADAGVLSGGGSGAVPAI
DGNAVTTCQQPADTLFGGCATWYKSAPLAAIRAKAPNASVSYLDGTDANAAASAAAQADV
AIVFATQWQTEGLDLASLSLPDAKADPSNQQYDQNALIAAVAAKAKRVIVVLENGSPVLM
PWLANVHGVLDAWYPGAQGGQAIADLLFGDANPSGRLPLTFPKQEADLPQPTIDPSNLRN
VYAEGLAYGYRWFDAKAIEPLFPFGYGLSYTTYVLSAMSAQADAAGNVTVGVTVTNTGAR
AGMQTVQIYAALPASLGEPPKRLVGWTKVALQPGEARTVSIAVPAQRFAVWDASAHAWRI
GAGTYGLSAAASSRDPQALSQTVTLAAH
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttcgctgttccggtgttcgacgattgcgtccgcgtgcgcgctcacggtcctg
ctcgcgtcgtgcggtggcgacgacatccatgcgccgaccgaccccgacgcggcagccgac
cagcgcgcggccgcgctcgtcgcgcaactgacgaccgacgagaaactgcagctcgtgcat
ggcaccggcatgcccgcgctcagcctgggcggcccgtttccggccgacgcgctgaacggc
gcgagctacatcccgggcgtgccgcggctcggcattccggccgtcagcagcgccgattcg
gcaggtggcgtgaacgtgaagaatgcgcgcgtgaccgcgctgcccgcgcccgtcgcgctc
gcggcgacgtgggacccggctctcgcgggcacctacggcacgcgcatcgcgctcgaactg
cgcgcgctcggtttcgcggaagggctcggcggcggcgtgaacctcgcgcgcgagccgcgc
aacggccgcaccttcgaatacatgggcgaggacccggtgctcgcgggcacgctgagcgcc
gcgcgcacgcaggccacgcaggcgcagaaggtgatcgcgacgatcaagcatttcgcgttc
aacgaccaggaaaccaaccggatgacggtcgattcggtcgtcgacgagcggaccatgcgc
gaggccgaactcctcgcgttcgagatcggcgtgaaggacggccagccgggcaacgtgatg
tgcgcgtacaacaagctgaacggcgtgtatgcgtgcgagaacccgtatttgctgacgacg
gtgctgaagaacgagtggggcttcaagggcgtcgtgcagtcggactggggcgcgacgcat
tcgacggtcgcggccgtgcaggccgggctcgacgaggagcagccgggcgcggccgacgac
ggcaacgcgccgctcggctcgtacttcaattcgaagctgcgcgcggcgctgcaggccggc
agcgtgtcggtcgcgcggctgaacgacatggtgcagcgcaagctgcgcacgctgatccgc
atcggcgtgatggatgcgccgccgaagccgggcggcgcgatcgacgaggccgccggcaat
gccgacgcgctcgcgatcgcgcggcaagcggcggtgctgctgaagaacgcggccgcgccg
ggcgacacgcagccggtgctgccgctggccgccggcacgctcaagtcggtcgtcgtgatc
ggcgggcatgcggacgcgggcgtgctgtcgggcggcggctcgggtgcggtgccggcgatc
gacggcaacgcggtgacgacctgccagcaaccggccgacacgctgttcggcgggtgcgcg
acctggtacaagtccgcgccgctcgcggcgatccgcgcgaaggcgccgaatgcatcggtc
agctatctcgacggcaccgacgcgaacgccgcggccagcgcggccgcgcaggccgatgtc
gcgatcgtgttcgccacgcagtggcagacggaggggctcgacctcgcgagcctgtcgctg
cccgatgcgaaggcggacccgtccaaccagcaatacgaccagaacgcgctgatcgccgcg
gtcgccgcgaaggccaagcgcgtgatcgtcgtgctcgagaacggcagcccggtgctgatg
ccgtggctcgcgaacgtgcacggcgtgctggacgcgtggtatccgggcgcgcagggcggc
caggcgatcgccgacctgctgttcggcgacgcgaacccgtcgggccggctgccgctgacg
ttcccgaagcaggaggccgacctgccacagccgacgatcgatccgtcgaacctgcggaac
gtctatgcggaagggctcgcgtacggctatcgctggttcgacgcgaaggcgatcgagccg
ctgttcccgttcggctacgggctgtcgtacacgacgtatgtgttgtcggcgatgtccgcg
caggccgacgcagcgggcaacgtgacggtcggcgtgacggtgacgaacacgggcgcgcgc
gccggtatgcaaacggtgcagatctacgcggcgctgcccgcgtcgctcggcgagccgccg
aagcggctcgtcggctggaccaaggtcgcgctgcagccgggcgaggcgcgcacggtcagc
atcgcggtgccggcgcagcgcttcgcggtgtgggatgcgagcgcgcacgcatggcggatc
ggcgcgggcacgtatgggttgtcggcggccgcgtcgtcgcgtgacccgcaggcgctgtcg
cagacagtgacgctcgccgcgcactga

DBGET integrated database retrieval system