KEGG   Burkholderia cenocepacia J2315: BCAL2656Help
Entry
BCAL2656          CDS       T00771                                 

Gene name
cobQ
Definition
(GenBank) putative cobyric acid synthase protein
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00860  Porphyrin and chlorophyll metabolism
bcj01100  Metabolic pathways
Module
bcj_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCAL2656 (cobQ)
Enzymes [BR:bcj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     BCAL2656 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: CAR52957
UniProt: B4E8E9
Position
1:complement(2925151..2926653)
Genome map
AA seq 500 aa AA seqDB search
MNAPEPRPRGTLMIQGTTSDAGKSTLVAGLCRLARRGGARVAPFKPQNMALNSAVTADGG
EIGRAQALQAMAAGVAPHTDFNPVLLKPTSDRGAQVIIHGKARMNLDARAYHDYKPVAFD
AVLESYARLRAGYDTVIVEGAGSPAEINLRDGDIANMGFAERVDCPVVLVADIDRGGVFA
HLVGTLACLSDSERARVRGFVINRFRGDLKLLEPGLDWLRARTGKPVFGVLPYLHGLLLD
AEDMLPAQARSAAARGDAGVLRVVVPALPRISNHTDFDPLRAHPQVEFTYWKSGPVPDAD
LLILPGSKSVQRDLAWLRDAGWDALIRRHLRYGGKVIGICGGMQMLGRTLDDPLGLEGAP
GSVPGLGLLDFDTMLQPDKTLKNVTGHVALPGEAAVRGYEIHMGDTRGPALATPALMLAA
DTAQGGARPDGARSADGQILATYVHGLFDAPDACAALLAWAGLDGTARIDYPALREASLE
RLADTFAEHLDLDALYAEFR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacccgagccgcggccgcgcggcacgctgatgatccagggcacgacgtccgac
gcgggcaagagcacgctcgtcgcgggcctgtgccgcctcgcgcgccgcggcggcgcgcgc
gtggccccgttcaagccgcagaacatggcgctcaacagcgcggtgacggccgatggcggc
gagatcggccgtgcgcaagcgctgcaggcgatggccgccggcgtcgcgccgcatacggat
ttcaatccggtgctgctgaaaccgacgagcgaccgcggcgcgcaggtgatcattcacggc
aaggcgcgcatgaacctcgacgcgcgggcgtatcacgactacaagccggtcgcattcgat
gcggtgctcgaatcgtacgcgcgcctgcgcgccggttacgacacggtgatcgtcgaaggc
gccggcagtccggccgagatcaacctgcgcgatggcgacatcgcgaacatggggtttgcc
gagcgggtcgactgcccggtcgtgctcgtcgccgacatcgatcgcggcggcgtgttcgcg
catctggtcggtacgctcgcatgcctgtcggacagcgagcgcgcacgtgtgcgcggcttc
gtgatcaaccgctttcgcggcgacctcaagctgctcgaaccagggctcgactggctgcgc
gcgcggacgggcaagccggtgttcggcgtgctgccgtatctgcacgggctgctgctcgac
gcggaggacatgctgcccgcgcaggcgcgcagcgccgccgcacggggcgatgccggcgtg
ctgcgcgtggtggtgcccgcgctgccgcgcatcagcaaccacactgatttcgatccgctg
cgcgcgcatccgcaggtcgaattcacgtactggaagagcggcccggtgccggacgccgac
ctgctgatcctgcccggttcgaagagcgtgcagcgcgacctcgcgtggttgcgcgacgcg
ggctgggacgcgctgatccggcgccatctgcgctacggcggcaaggtgatcggcatctgc
ggcggcatgcagatgctcggccgtacgctcgacgatccgctcggcctcgaaggcgcgccc
ggcagcgtgccggggctcgggctgctcgatttcgacacgatgctgcagcccgacaagacg
ctgaagaacgtgaccgggcacgtcgcgctgccgggcgaggctgccgtgcgcggctacgag
atccatatgggcgacacgcgcgggccggcgctcgcgacgcccgcgctgatgctggccgcc
gataccgcgcagggcggcgcacgtcccgacggcgcgagatcggccgacggccagatcctc
gcgacctacgtgcacgggctgttcgacgcccccgacgcctgcgcggcgctgcttgcatgg
gcagggctcgacgggacggcccgcatcgactacccggcgctgcgcgaggcgtcgctcgag
cggctggccgacacgttcgccgagcacctcgacctcgacgcgctgtacgccgagtttcgt
tga

DBGET integrated database retrieval system