KEGG   Burkholderia cenocepacia J2315: BCAL2839Help
Entry
BCAL2839          CDS       T00771                                 

Gene name
cbbA
Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00010  Glycolysis / Gluconeogenesis
bcj00030  Pentose phosphate pathway
bcj00051  Fructose and mannose metabolism
bcj00680  Methane metabolism
bcj00710  Carbon fixation in photosynthetic organisms
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01200  Carbon metabolism
bcj01230  Biosynthesis of amino acids
Module
bcj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAL2839 (cbbA)
   00030 Pentose phosphate pathway
    BCAL2839 (cbbA)
   00051 Fructose and mannose metabolism
    BCAL2839 (cbbA)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BCAL2839 (cbbA)
   00680 Methane metabolism
    BCAL2839 (cbbA)
Enzymes [BR:bcj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BCAL2839 (cbbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: CAR53139
UniProt: B4EA23
Position
1:complement(3118410..3119474)
Genome map
AA seq 354 aa AA seqDB search
MPLVSMRQLLDHAAEHGYGLPAFNVNNLEQVQAIMAAADQVGAPVIMQASAGARKYAGEP
FLRHLIEAAVESYPHIPVVMHQDHGQSPAVCTAAIRSGFTSVMMDGSLEADGKTVASYEY
NVDVSRKVVEMAHSIGVTVEAELGVLGSLETMKGDKEDGHGAEGTMTREQLLTDPEQAAD
FVKLTQCDALAIAIGTSHGAYKFSKKPTGDILSIQRIKEIHARIPNTHLVMHGSSSVPQE
LLAEIREFGGDMKETYGVPVEEIQEGIKHGVRKINIDTDLRLAITGAIRRYLFENPGKFD
PRDYLKPAREAAKKVCVDRYLAFGCEGQAGKIKPVSLDKIAEQYKSGALAQVVR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcgtatcaatgcgtcaattgctggaccacgcggcagagcacggttacggcctg
ccggccttcaacgtgaacaacctggagcaggtccaggcgatcatggcggcggcggaccag
gtcggcgcgcccgtgatcatgcaggcatcggccggcgcgcgtaagtatgccggcgagccg
ttcctgcgccacctgatcgaagcggcggtcgaatcgtatccgcacatcccggtcgtgatg
caccaggatcacggccagtcgccggccgtctgcacggccgcgatccgcagcggcttcacg
agcgtgatgatggacggttcgctcgaagccgacggcaagacggtcgcgtcgtacgagtac
aacgtcgacgtgtcgcgcaaggtcgtcgagatggcgcactcgatcggcgtgacggtcgaa
gccgaactcggcgtgctcggctcgctcgagacgatgaagggcgacaaggaagacggccat
ggcgcggaaggcacgatgacccgcgagcagctgctgaccgatccggagcaggccgccgac
ttcgtcaagctcacgcagtgcgatgcactcgcgatcgcgatcggtacgtcgcacggcgcg
tacaagttctcgaagaagccgacgggcgacatcctgtcgatccagcgcatcaaggaaatc
cacgcgcgcatcccgaacacgcacctcgtgatgcacggttcgtcgtcggtgccgcaggag
ctgctggccgagatccgcgaattcggcggcgacatgaaggaaacctacggcgtgccggtc
gaggaaatccaggaaggcatcaagcacggcgtgcgcaagatcaacatcgacaccgacctg
cgtctcgcgatcaccggcgcgatccgccgctacctgttcgagaacccgggcaagttcgat
ccgcgcgactacctgaagcccgcgcgcgaagcggcgaagaaggtgtgcgtcgaccgttac
ctcgcgttcggctgcgaaggccaggccggcaagatcaagccggtgtcgctcgacaagatc
gccgagcagtacaagtcgggcgcgctcgcacaggtcgtgcgctga

DBGET integrated database retrieval system