KEGG   Burkholderia cenocepacia J2315: BCAM0326
Entry
BCAM0326          CDS       T00771                                 

Definition
(GenBank) putative type IV secretion system protein VirB3
  KO
K03198  type IV secretion system protein VirB3
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BCAM0326
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcj02044]
    BCAM0326
Secretion system [BR:bcj02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BCAM0326
SSDB
Motif
Pfam: VirB3 MFS_2 DUF3487 PrgI
Other DBs
NCBI-ProteinID: CAR54185
UniProt: B4EIR7
Position
2:380678..381016
AA seq 112 aa
MNTELIVDTLSDPVFKGCTRPAMLWGVPLVPLLTVGGGMLIPAIWVLMASAALGVAIALL
IVPVFATMRMITRQDDQRLAQRMLRAKMRLHQRNRRFWGAHAYAPIRFKARG
NT seq 339 nt   +upstreamnt  +downstreamnt
gtgaacacggagctgattgtggacacactctctgatcccgtattcaaaggctgcacgcgg
ccagcgatgctatggggcgttccacttgtaccgctgttgacggtcggtggcggtatgctg
atcccggcaatctgggtattgatggcgagtgcggctttgggcgtcgcaatcgcactgttg
atcgttcccgtgttcgcgacaatgcgcatgattacgcgtcaggacgaccaacgtctcgct
cagcgcatgctacgcgcgaaaatgagactgcaccagcgcaaccgacgcttctggggcgcg
catgcctatgcgccgatccgatttaaggcgcgagggtga

DBGET integrated database retrieval system