KEGG   Burkholderia cenocepacia J2315: BCAM0425Help
Entry
BCAM0425          CDS       T00771                                 

Definition
(GenBank) putative exported protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3138 BBP2 FlgM SlyX DUF4407
Motif
Other DBs
NCBI-ProteinID: CAR54283
UniProt: B4EJE8
Position
2:479059..480657
Genome map
AA seq 532 aa AA seqDB search
MNIKHMTVLCALAFDTAAAFAHTPHATDANRMKALQAQVTALQRQVNALRASMLAAKPAG
AATTAAPPPTVTTAASAGAKIGTINTAAAAAQAAESAPAFTNDDLQQMREQIANASLKVD
ALQEAATTGPLAGLSITGYVDPVYLFNRAQHTSGFQFLNHDPGAYDYFNSTIGDVYLDIR
KTFGVGPMAPSAEIVIQPNRGFGNVFSNAHGGIGNNIVTQAQVNVPLGTTRTFEIGMMPS
LAGYEVQPSNQMLTLTHGLLYDFSEPGNLVGIGLKGSNAAMTRFWQVVIGNEVLRTAGAI
ANAANNTTKPNWTPTITARFDNATSTAFDFGLSGMLGRQSLFSPCAAGGYGYQCNGSSPT
GLYKYVEADMTYTHDKTQINAQVDYGELQKGAWNGGTARWYGMSLLGHTKWTTSWLGRMG
ATLRFDYLNNASNGGGGTNIQYGLAGGNPSVNGSSGFGIDPSCFQGSATNGTECKGAQRY
AITADLLFYPTQQITVKVEYRHDAANHPVFLKSNGTYARSNDLAGMQFIYSF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaaacacatgacggtgctgtgcgcgctcgcgttcgacacggccgcggcattc
gcccacacaccgcacgcgaccgacgcgaaccggatgaaggcattgcaggcgcaggtcacc
gcgctgcagcggcaggtgaacgcgctgcgcgcgagcatgctggcggcgaagccggccggc
gcggccacgaccgccgcgcctcccccgaccgtcacgaccgccgcatcggccggcgcgaag
atcggcacgatcaatacggccgcggccgccgcgcaggctgccgagtcggcgcccgcgttc
acgaacgacgacctgcagcagatgcgcgagcagatcgcgaacgcgtcgctgaaggtcgat
gcgttgcaggaggcggcgacgaccggcccgctcgcgggcctgagcatcaccggctacgtc
gatcccgtgtacctgttcaaccgcgcgcagcacacgtccggcttccagttcctgaaccac
gatccgggcgcgtacgactacttcaacagcacgatcggcgacgtctacctcgacatcagg
aagaccttcggcgtcggcccgatggcgccgtcggcggagatcgtgatccagccgaaccgc
ggcttcggcaacgtgttcagcaatgcgcacggcggcatcggcaacaacatcgtcacgcag
gcgcaggtcaacgtgccgctcggcacgacgcgcacgttcgagatcgggatgatgccgagc
ctcgccggctacgaggtgcagccgtccaaccagatgctcacgctcacgcacggattgctg
tacgacttcagcgagccgggcaatctggtcggtatcgggctgaagggctccaacgcggcg
atgacgcgcttctggcaggtcgtgatcggcaacgaggtgctgcgcacggccggcgcgatc
gcgaatgcggcgaacaacacaacgaagccgaactggacgccgacgatcaccgcgcgcttc
gacaacgcgacgtcgacggcgttcgacttcggcctctccgggatgctcggccggcagtcg
ctgttctcgccgtgcgcggcgggcggctacggctaccagtgcaacggctcgtcgccgacc
ggcctctacaagtacgtggaagccgacatgacctatacgcacgacaagacgcagatcaac
gcacaggtcgactacggcgagctgcagaagggcgcatggaacggcggcacggcgcgctgg
tacgggatgtcgctgctcggccatacgaagtggacgacgtcgtggctcggccgcatgggc
gcgacgctgcgcttcgactacctgaacaacgcgtcgaacggcggcggtggcacgaacatc
cagtacgggctcgcgggcggcaacccgtcggtgaacgggtcgagcggcttcggcatcgat
ccgtcgtgcttccagggctcggcgacgaacggcaccgagtgcaagggcgcgcaacgctat
gcgatcacggccgacctgttgttctatccgacgcaacagatcaccgtgaaggtcgaatac
cgccacgacgcggcgaatcatccggtgttcctgaagagcaacggcacctatgcgcgcagc
aacgacctggccggcatgcagttcatctattcgttctga

DBGET integrated database retrieval system