KEGG   Burkholderia cenocepacia J2315: BCAM0427Help
Entry
BCAM0427          CDS       T00771                                 

Gene name
dgoT
Definition
(GenBank) D-galactonate transporter
  KO
K08194  MFS transporter, ACS family, D-galactonate transporter
Organism
bcj  Burkholderia cenocepacia J2315
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcj02000]
    BCAM0427 (dgoT)
Transporters [BR:bcj02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    BCAM0427 (dgoT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: CAR54285
UniProt: B4EJF0
Position
2:complement(481895..483286)
Genome map
AA seq 463 aa AA seqDB search
MGQSASRTHANPPERPSAHPGALPESRSAARATATATTPPSRKRLLILALLFVTVVINYL
DRSNLSIAAPELFKELNIDPVRAGLVFSAFGWTYALMQIPGGWLVDKVSPRVLYAGALAL
WSAATLLLGFAGSFVGLIVLRLAVGALEAPAYPINNRVVTTWFPTRERASAIGGYTSGQF
VGLAFLTPVLAWLQVHLGWHMVFVATGLAGIAWAAIWYAVYREPRALRGVNAAEIALIRD
GGGLVDLEDRVAARSERAPSTWRDLGVVLGRRKLWGIYLGQFALNSTLWFFLTWFPTYLV
KYRGMDFIKSGFLASLPFLAAFVGVLCSGVLSDWLMRRGASQGFARKLPIISGLLISTCI
IGANYVSSTGWVIAFMTIAFFGNGFASITWSLVSGLAPARLLGLTGGVFNLVGNLSAIAT
PIVIGLLVDGADFSHAITYIAAMALAGSLSYGLLVGKVERIDA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgggccaatccgcgtcacgcacccatgccaacccgccggagcggccatccgcgcacccc
ggcgccttacccgaatcccgatccgccgcccgcgcgacagcgaccgccaccacgccgccg
agccgcaagcggctgctgattctcgcgctgctgttcgtcaccgtcgtgatcaactatctc
gaccgcagcaacctgtcgatcgcggcgcccgagctgttcaaggaactgaacatcgatccg
gttcgcgcgggcctcgtgttctccgcgttcggctggacctatgcgctgatgcagattccg
ggcggctggctcgtcgacaaggtatcgccgcgcgtgctgtatgcgggcgcgctcgcactg
tggtcagccgcgacgctgctgctcggcttcgccggttcgttcgtcgggctgatcgtgctg
cgcctcgcggtgggcgcgctcgaagcgccggcctacccgatcaacaaccgcgtggtgacg
acgtggttcccgacccgcgaacgcgcaagcgcgatcggcggctacacgtcgggccagttc
gtcggcctcgcgttcctcacgccggtgctcgcgtggctgcaggtgcatctcggctggcac
atggtgttcgtcgcgaccggcctcgccggcatcgcgtgggccgcgatctggtacgcggta
tatcgcgagccgcgcgcgttgcgcggcgtcaacgcggccgaaatcgcgctgatccgcgac
ggcggcggcctcgtcgatctggaggaccgcgtcgcggcgcgcagcgaacgcgcgccgtcg
acgtggcgcgacctcggcgtcgtgctcggccggcgcaagctgtggggcatctacctcggc
cagttcgcgctgaactcgacgctgtggttcttcctcacgtggttcccgacctacctcgtc
aagtatcgcgggatggatttcatcaagtcgggcttcctcgcgtcgttgccgttcctcgcc
gcgttcgtcggcgtgctgtgctcgggcgtgctgtcggactggctgatgcggcgcggcgca
tcgcagggcttcgcgcgcaagctgccgatcatctcggggctgctgatctcgacctgcatc
atcggcgcgaactacgtgagctcgaccggctgggtaatcgcgttcatgacgatcgcattc
ttcggcaacggcttcgcgtcgatcacgtggtcgctcgtgtcggggctcgcgcctgcacgg
ctgctcggcctcacgggcggcgtgttcaacctggtcggcaacctgtccgcgatcgcgaca
ccgatcgtgatcgggctgctggtcgacggtgcggacttctcgcacgcgatcacctacatc
gccgcgatggcgctcgcgggcagcctgtcgtacgggctgctcgtcggcaaggtcgagcgc
atcgacgcctga

DBGET integrated database retrieval system