KEGG   Burkholderia cenocepacia J2315: BCAM0444Help
Entry
BCAM0444          CDS       T00771                                 

Definition
(GenBank) putative exported protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAR54302
UniProt: B4EJG7
Position
2:499490..499846
Genome map
AA seq 118 aa AA seqDB search
MSYWRTFLVVVSLALSLPIQSFAAVSMQCASVAAPHEEKVSHAMPAAQDGHADHGDHARH
ASSCVACVSCCFGTGMSGAPAVPAAASGGVTIVAPPPSAADVSFLTGGIDRPPRRMPA
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtactggcgcacattcctcgtcgtcgtgtcgctcgcgctgagcctgccgatccag
tcgttcgcggctgtttcgatgcagtgcgcgagcgtcgccgcgccgcatgaggagaaggtg
tcgcacgcgatgccggccgcgcaggatggtcatgccgatcacggcgaccacgcgcggcat
gcgtcgtcgtgtgtcgcgtgcgtgtcctgctgcttcggcacgggcatgtcgggggcgcct
gcggtgccggccgcggcgagcggcggcgtcacgatcgtcgcgccgccgccttcggctgcg
gacgtgtcgttcctgaccggcggcatcgaccggccgccgcgccggatgcccgcctag

DBGET integrated database retrieval system