KEGG   Burkholderia cenocepacia J2315: BCAM0446Help
Entry
BCAM0446          CDS       T00771                                 

Definition
(GenBank) outer membrane efflux protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OEP
Motif
Other DBs
NCBI-ProteinID: CAR54304
UniProt: B4EJG9
Position
2:500213..501727
Genome map
AA seq 504 aa AA seqDB search
MTTFAISPRIGPAVVALAFLAGCTTFSKDGGFDAVSSAASARIGKDAVVVRTDADREAVD
RRTKELLGKPLSMDDAVQVALLNNRGLQASYAELGLSEADLVQAGRLPNPRFAFSRTRAG
DGELTLGRTFSANVFALLTMPLATKIERRRFEQTRLETADAMLKVAADARRAYVEAVAAE
QAANYAQQVRDAASAAAELALRMRQAGNFSRLDYAREQAFHADAVAQHAKARQQAVAARE
KLTRAMGLWGERTRYALPERLPDLPKARPDLPDLERFAMRNRLDIQAAKLRTQGVASSLG
LSKATRFVNAVELGYVNDYETGKGHEHGYEISVEIPLFDWGGAKVARAEAVYMQSANLLA
KTAIDARSEVRESYAAYVTSYDVATHYRDEVVPLRKTISDELLLRYNGMLASVFELLTDA
REQVGAVNGYIDALKDYWLAETDLQMAVGGRLPSSGAAPRAPHDAESAPASRSASTLGAD
AARQPASTPAAPSAPATQPHPEGH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgttcgcgatatcgccgaggatcggcccggccgtggtcgcgctggcgttcctc
gcgggctgcacgacgttttcgaaggacggcgggttcgacgccgtgtcgtccgccgcatcg
gcgcgcatcggcaaggacgcggtggtggtcaggaccgacgccgaccgcgaagccgtcgac
cggcggacgaaggaactgctcggcaagccgctgtcgatggacgacgcggtgcaggtcgcg
ctgctgaacaaccgcgggctgcaggcgtcgtacgcggaactcgggctgtcggaggccgac
ctcgtgcaggccggccggttgccgaacccgcgcttcgcattcagccgcacgcgtgccggc
gacggcgagctgacgctcggccgcacgttctcggcgaacgtgttcgcgctgctgacgatg
ccgcttgcaacgaagatcgagcgccgccgtttcgagcagaccaggctggaaacggccgat
gcgatgctgaaggtcgcggccgatgcgcgccgggcctacgtggaagcggtcgccgccgag
caggccgcgaactatgcgcagcaggtgcgcgacgccgccagcgcggccgccgaactggcg
ctgcgcatgcggcaggccggcaacttcagccggctcgactacgcgcgcgaacaggcgttt
catgccgacgcggtcgcgcagcacgcgaaggcgcgccagcaggccgtcgccgcacgcgag
aagctcacgcgtgcgatggggctgtggggcgaacgcacgcgatacgcgctacccgaacgc
ctgccggatttgccgaaggcgcgcccggatctgcccgatctcgaacgcttcgcgatgcgc
aaccgcctcgacatccaggcggcgaagctgcggacgcagggcgtcgcgtcgtcgctcggc
ctgagcaaggccacgcgtttcgtcaacgcggtcgagctcggttacgtgaacgactacgag
accggcaagggccacgagcacggctacgagatcagcgtcgagattccgctgttcgactgg
ggcggcgcgaaggtcgcgcgcgccgaggccgtctacatgcaatcggcgaacctgctcgcg
aaaacggccatcgatgcccgctccgaagtacgcgaatcgtacgcggcgtacgtgacgagc
tacgacgtcgcgacgcactatcgcgacgaagtcgtgccgctgcgcaagacgatttccgac
gaactgctgctgcgctacaacgggatgctcgcgagcgtgttcgagctgctgaccgatgcg
cgcgaacaggtcggcgcggtcaacggctacatcgacgcgctgaaagactactggctcgcc
gaaaccgatctgcagatggccgtcggcggccggttgccgtcgtcgggcgccgcgccgcgc
gcaccgcatgacgccgaatcggcacccgcatccagatccgcatccacactcggcgccgac
gctgcgcggcagccggcttccacccccgcggcgccatcggcgcccgccacgcaaccgcat
ccggaaggtcattga

DBGET integrated database retrieval system