KEGG   Burkholderia cenocepacia J2315: BCAM0452Help
Entry
BCAM0452          CDS       T00771                                 

Definition
(GenBank) serine peptidase, family S10
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S10 SPATA3
Motif
Other DBs
NCBI-ProteinID: CAR54310
UniProt: B4EJV6
Position
2:507468..509315
Genome map
AA seq 615 aa AA seqDB search
MKPDRSSTGSRRVRRGRLAGLGALSAMTLALAACGGDDSSSVGASSLAQATASQQASAQA
AGTQAPAANQPYVDPVAYSMNATDGLAPSQVSEKAAVMHYQWTGGGKTINYTTTTGHLTA
QDANGNAEASMSYVAYTAPSTNGKPRPVTFVYNGGPGSSSIWLRLGSFAPTRVATPDPLF
GNNWPNYPLVDNAESLIDTTDLVFIDPPGTGLSEAVLPNTNQKYWGSDVDVNIMRDFIQR
YLNVNSRGTSPIYLYGESYGTPRTDMLALALESAGVHLTGIVLQSSILNYFADAVEAVAI
TQSTEGLLLDTDTVAGYLPGYAAVAAYFNQVSPAPVNQDLYAFQTELFTTLIYSQLQKYS
QSWVLSQLGIPDALGTPVFPSDATLRLWSIPSSLTQQALRGYFNANPFGTSLLPGTTIGR
YDGRVSLPNSDPRLQTDGDPSDILISQPFTNALATQMPDYLGYTAPNATYLPLNDNIIGV
WDFSHDGQPMPDTIPDLLGALQLNPKLRVLAENGYHDLATPFFNTEKQLARLQTVKGLNP
KLQVNFFQGGHMTYLDDVARPLMKRDLQTFYKGARIPTALTLHTLPPPWPDENPPSVPTG
SVPGATAATTLAAAP
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagacaggagcagtaccggcagccgccgtgttcgtcgcggccggctggccggg
ctcggtgcgttgtcggccatgacgctggcgctcgcggcgtgcggcggcgacgattcgtcg
tcggtcggcgcgtcgagtctcgcgcaggccaccgcgagccagcaggcgagcgcgcaggcg
gccggcacccaggcgccggcggccaaccagccgtacgtcgacccggtcgcgtactcgatg
aacgcgaccgacggcctcgcgccgtcgcaggtgtccgagaaggcggccgtcatgcattac
cagtggaccggcggcggcaagacgatcaactacacgacgaccaccggccacctgaccgcg
caggacgcgaacggcaatgcggaagcgtcgatgtcgtatgtcgcgtacaccgcgcccagc
acgaacggcaagccgcgcccggtcacgttcgtctacaacggcgggcccggctcgtcgtcg
atctggctgcggctcggctcgttcgcgccgacccgcgtggccacgcccgatccgctgttc
ggcaacaactggccgaactacccgctcgtcgacaatgcggagagcctgatcgacaccacc
gacctcgtgttcatcgacccgcccggcaccgggctgtcggaagccgtgttgccgaacacc
aaccagaagtactggggctccgacgtggacgtgaacatcatgcgcgacttcatccagcgc
tacctgaacgtcaacagtcgcggcacgtcgccgatctacctgtacggcgaatcgtacggc
acgccgcggaccgacatgctcgcgctcgcgctcgaatcggccggcgtgcacctgacgggc
atcgtgctgcagtcgtcgatcctgaactacttcgcggatgcggtggaagcggtggcgatc
acgcagtcgaccgaagggctgctgctcgataccgatacggtagccggctacctgcccggc
tacgcggcggtcgccgcgtacttcaaccaggtgtcgccggcgccggtgaaccaggatctg
tacgcattccagacggaactgttcacgacgctgatctacagccagctgcagaagtactcg
caatcgtgggtgttgagccagctcggcattccggatgcgctcggcacgccggtgttcccg
agcgatgcgacgctcaggctgtggtcgatcccgtcgagcctcacgcagcaggcgctgcgc
ggctacttcaacgcgaatccgttcggcacgagcctgctgcccggcacgacgatcggccgc
tacgacgggcgcgtgtcgttgccgaactcggacccgcggctgcagaccgacggcgatccg
tccgacatcctgatctcgcagccgttcacgaacgcgctcgcgacgcagatgccggactac
ctcggctatacggccccgaacgcgacgtacctgccgctgaacgacaacatcatcggcgtc
tgggacttctcgcacgacggccagccgatgccggacacgatccccgatctgctcggcgcg
ctgcagctcaacccgaagcttcgcgtgctcgcggagaacggctaccacgatctcgcgacg
ccgttcttcaacaccgagaagcaactcgcgcggctgcagacggtgaagggcctgaatccg
aaactgcaggtgaacttcttccagggcggccacatgacttacctggacgacgtcgcccgt
ccgctgatgaagcgggacctgcagacgttctacaagggcgcgcggattccgacggcgctg
acgctgcacacgctgccgccgccgtggccggatgaaaacccgccgagcgttccgaccggc
agcgtcccgggcgcgacggccgcgacgacgctggcggcagccccttga

DBGET integrated database retrieval system