KEGG   Burkholderia cenocepacia J2315: BCAM0461Help
Entry
BCAM0461          CDS       T00771                                 

Definition
(GenBank) putative amino acid ABC transporter system permease
  KO
K10009  cystine transport system permease protein
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj02010  ABC transporters
Module
bcj_M00234  Cystine transport system
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BCAM0461
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcj02000]
    BCAM0461
Transporters [BR:bcj02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234] [OT]
    BCAM0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: CAR54318
UniProt: B4EJW3
Position
2:complement(515408..516058)
Genome map
AA seq 216 aa AA seqDB search
MLDLFVRSLPLLESAVTMTVFLGLASFALGSALGLAVALARVSSIRFLRGIAFAYVSIFR
GTPLLVQILLIYFGLPRYGITLDPVPAALLALTLFSAAYLSENFRSGINAVDRGQWEAAH
SLGMNYWKMMWRVILPQGLRIAIPPVGSRMIALIKDTSLASTITVVELTRVADQVGASTF
RYMEMFLMVGLIYWVINQILTIVQTIFEGRVSRRFQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatctcttcgtgcggtcgctgccgctgctcgaaagcgcggtgacgatgaccgtg
ttcctcggcctcgcttcgttcgcgctcggctcggcgctggggctcgccgtcgcgctcgcg
cgggtgtcgtcgatccgcttcctgcgcggcatcgcgttcgcgtacgtgtcgatctttcgc
ggcacgccgctgctggtgcagatcctgctgatctacttcgggctgccgcgctacggcatc
acgctcgacccggtaccggccgcgctgctcgcgctcacgctgttctccgcggcgtacctg
agcgagaacttccgctccgggatcaacgcggtcgatcgcggccagtgggaagccgcgcat
tcgctcggcatgaactactggaagatgatgtggcgcgtgatcctgccgcaggggctgcgc
atcgcgatcccgcccgtcggcagccggatgatcgcgctgatcaaggatacgtcgctggcg
tccacgatcaccgtcgtcgaactcacccgcgtggccgaccaggtcggcgcgtcgaccttc
cgctacatggagatgttcctgatggtcggcctgatctactgggtcatcaaccagatcctg
acgatcgtccagacgatcttcgaaggccgcgtgtcgcggcgctttcaatga

DBGET integrated database retrieval system