KEGG   Burkholderia cenocepacia J2315: BCAM0461Help
Entry
BCAM0461          CDS       T00771                                 

Definition
(GenBank) putative amino acid ABC transporter system permease
  KO
K10009  L-cystine transport system permease protein
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj02010  ABC transporters
Module
bcj_M00234  L-Cystine transport system
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BCAM0461
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcj02000]
    BCAM0461
Transporters [BR:bcj02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234]
    BCAM0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: CAR54318
UniProt: B4EJW3
Position
2:complement(515408..516058)
Genome map
AA seq 216 aa AA seqDB search
MLDLFVRSLPLLESAVTMTVFLGLASFALGSALGLAVALARVSSIRFLRGIAFAYVSIFR
GTPLLVQILLIYFGLPRYGITLDPVPAALLALTLFSAAYLSENFRSGINAVDRGQWEAAH
SLGMNYWKMMWRVILPQGLRIAIPPVGSRMIALIKDTSLASTITVVELTRVADQVGASTF
RYMEMFLMVGLIYWVINQILTIVQTIFEGRVSRRFQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatctcttcgtgcggtcgctgccgctgctcgaaagcgcggtgacgatgaccgtg
ttcctcggcctcgcttcgttcgcgctcggctcggcgctggggctcgccgtcgcgctcgcg
cgggtgtcgtcgatccgcttcctgcgcggcatcgcgttcgcgtacgtgtcgatctttcgc
ggcacgccgctgctggtgcagatcctgctgatctacttcgggctgccgcgctacggcatc
acgctcgacccggtaccggccgcgctgctcgcgctcacgctgttctccgcggcgtacctg
agcgagaacttccgctccgggatcaacgcggtcgatcgcggccagtgggaagccgcgcat
tcgctcggcatgaactactggaagatgatgtggcgcgtgatcctgccgcaggggctgcgc
atcgcgatcccgcccgtcggcagccggatgatcgcgctgatcaaggatacgtcgctggcg
tccacgatcaccgtcgtcgaactcacccgcgtggccgaccaggtcggcgcgtcgaccttc
cgctacatggagatgttcctgatggtcggcctgatctactgggtcatcaaccagatcctg
acgatcgtccagacgatcttcgaaggccgcgtgtcgcggcgctttcaatga

DBGET integrated database retrieval system