KEGG   Burkholderia cenocepacia J2315: BCAM0462Help
Entry
BCAM0462          CDS       T00771                                 

Definition
(GenBank) cystine-binding periplasmic protein precursor
  KO
K02424  cystine transport system substrate-binding protein
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj02010  ABC transporters
Module
bcj_M00234  Cystine transport system
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BCAM0462
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcj02000]
    BCAM0462
   02035 Bacterial motility proteins [BR:bcj02035]
    BCAM0462
Transporters [BR:bcj02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234] [OT]
    BCAM0462
Bacterial motility proteins [BR:bcj02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    BCAM0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Phosphonate-bd Lig_chan-Glu_bd NMT1
Motif
Other DBs
NCBI-ProteinID: CAR54319
UniProt: B4EJW4
Position
2:complement(516062..516901)
Genome map
AA seq 279 aa AA seqDB search
MNPQTTRVLARGLATLGIAGALALSSLDAGAADLLAAARGSGTLRVANTQSSPPWSLLDE
RNQPAGYDVEVAREVGKRIGVKQVVFVADAYKNFVEGLKAGKYDLVMNDLTPTAERSKQV
DFAKPYGVEDFRIFVRTDNTHIHGQADLKGKRVGVTTGSSNETWARAHLKDADIRAYDNG
GLVFNDLGSGRLDAVIISHFGGMKYANVNHLPVKEVGEPLIYQLSAPALAKGQPALLAAV
DKAIDDMAADGTLERLAKRWVGPTYDMVGNIARAKAQKE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctcagaccacccgcgttctggccagaggcctggccacgctcggcatcgcgggc
gcgctcgcgttgtcgagcctcgatgccggcgcggccgacctgctcgctgccgcgcgcggc
agcggcacgctgcgcgtcgcgaacacgcagagcagcccgccgtggagcctgctggacgag
cgcaaccagccggccggctacgacgtcgaagtcgcgcgcgaagtcggcaagcgcatcggc
gtgaagcaggtcgtgttcgtcgcggacgcgtacaagaacttcgtcgaagggctcaaggcc
ggcaaatacgatctggtgatgaacgacctgacgccgacggccgagcgcagcaagcaggtc
gatttcgcgaaaccgtacggcgtcgaggatttccggatcttcgtgcgcaccgacaacacc
cacattcacgggcaggccgacctgaaaggcaagcgcgtcggcgtgaccacgggctcgtcg
aacgaaacctgggcacgcgcgcacctgaaggacgccgacattcgcgcgtacgacaacggc
ggcctcgtgttcaacgatctcggcagcggccgcctcgatgcggtcatcatttcccacttc
ggcgggatgaaatacgcgaacgtgaatcacctgccggtcaaggaagtcggcgagccgctg
atctatcagctgtccgcgccggcgctcgcgaagggacaaccggcgctgctcgccgccgtc
gacaaggcgatcgacgacatggccgccgacggcacgctcgaacggctcgcgaagcgctgg
gtcggcccgacctacgacatggtcggcaacatcgcgcgggcgaaagcgcagaaggagtga

DBGET integrated database retrieval system