KEGG   Burkholderia cenocepacia J2315: BCAM0463Help
Entry
BCAM0463          CDS       T00771                                 

Gene name
metC
Definition
(GenBank) putative cystathionine beta-lyase
  KO
K01760  cystathionine beta-lyase [EC:4.4.1.8]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00270  Cysteine and methionine metabolism
bcj00450  Selenocompound metabolism
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BCAM0463 (metC)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BCAM0463 (metC)
Enzymes [BR:bcj01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.8  cystathionine beta-lyase
     BCAM0463 (metC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CAR54320
UniProt: B4EJW5
Position
2:complement(516957..518120)
Genome map
AA seq 387 aa AA seqDB search
MTTTPPLPPQPFRSLSPAVMRASTVVFDSLDDFARRKERQPDGYSYGITGTPTARELERR
IAVLEGGAHCVLAPSGQAALMTSVMGFVRGGDHLLVSAACYGALKTFAQKWLALFDVDVE
LYEPAIGADIERYVKPNTRMICMESPGTVTMEMPDVPAIVDVARRHRIMTMMDNTWASPL
AFRPLEHGVDLSVEAATKLFGGHSDLLLGAISMNDFGYYETLRETQSILGQQASPDDCFL
VLRGLDTLKVRFDAQSAAALRVAQALESHPAVRQVLFPALPSDAGHAIWKRDFSGNGCLF
SLMLEPAPEAAFTAFFDALRHFAIGASWGGVHSLAAYYPAPLQAQRRFPLTDQPIVRLSI
GLEAPELLIDDLYTGLAAFTDVRNHAA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaccccgccgctccctccgcaaccgttccgcagcctgtcgccggcggtcatg
cgtgcctcgaccgtcgtattcgactcgctcgacgatttcgcccgccgcaaggaacgccag
cccgacggctacagctacggcatcaccggcacgccgaccgcgcgcgaactggagcgccgc
atcgccgtgctcgaaggcggcgcgcactgcgtgctggcgccgtccgggcaggccgcgctg
atgacgtccgtgatgggcttcgtgcgcggcggcgatcacctgctcgtgtcggccgcgtgc
tacggcgcgctgaagaccttcgcgcagaaatggctcgcgctgttcgacgtggacgtcgag
ctgtacgaaccggcgatcggcgccgacatcgagcggtacgtgaaaccgaatacgcggatg
atctgcatggaatcgccgggcacggtgacgatggaaatgccggacgtgccggcgatcgtc
gacgtcgcgcgccgccatcgcatcatgacgatgatggacaacacgtgggccagcccgctc
gcgtttcgaccgctcgaacatggcgtggacctgagcgtcgaagcggccacgaagctgttc
ggcggtcactccgatctgctgctcggcgcgatcagcatgaacgacttcggctactacgag
acgctgcgcgagacgcagagcatcctcggtcagcaggcgagccccgacgactgtttcctc
gtgttgcgcggcctcgacaccctgaaggtgcgcttcgatgcgcaaagcgcggcggcgctg
cgcgtcgcgcaggcgctcgaatcgcatccggcggttcgccaggtgctgtttcccgcactg
ccgtccgacgcggggcacgcgatctggaagcgcgatttctccggcaacggctgcctgttt
tcgctgatgctcgaacccgcgccggaagccgcgttcaccgcgttcttcgatgcgctgcgc
cacttcgcgatcggcgcgagctggggcggcgtccacagcctcgccgcgtactacccggcg
ccgctgcaggcgcagcgccggttcccgctgaccgaccagccgatcgtgcgcctgtcgatc
ggactcgaagcccccgagctgctgatcgacgatctgtacacggggctcgccgcgttcacc
gacgtcagaaaccacgcagcgtaa

DBGET integrated database retrieval system