KEGG   Burkholderia cenocepacia J2315: BCAM0470Help
Entry
BCAM0470          CDS       T00771                                 

Gene name
macA
Definition
(GenBank) maleylacetate reductase
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CAR54327
UniProt: B4EJX2
Position
2:525042..526109
Genome map
AA seq 355 aa AA seqDB search
MERFVYQGTPSRVVFEWGALDRLPDELSALGARRALILSTPEQQPLADRVKDVLGERAAG
VCAEAVMHVPVEVARAARETAAELGADCCIAIGGGSTIGLGKAIALESSLPILAVPTTYA
GSEMTPIYGLTEGRLKRTGRDARVLPRTVIYDPSLTVSLPPGISAASGVNAMAHAVEALY
AEDANPVISLMAEESIRALGEALPVVVRDPQDRAMRSRALYGAWLAGTCLGAVGMALHHK
LCHTLGGTFNLPHAQTHAAMLPHTAHYNHAAAPDALRRVARALGGSDAADAGPLLFRLNA
QLGIAPALADIGMPQQGLDEAADLACRNPYANPRPIERAAIRALLQHAWEGRAPH
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcttcgtctatcagggcaccccgtcgcgcgtggtcttcgaatggggcgcgctc
gacaggctgccggacgagctgtcggcgctcggcgcccgccgcgcgctcatcctttccacg
cccgaacagcagccgctcgccgatcgcgtgaaggacgtgctgggcgaacgtgcggccggc
gtgtgcgccgaggccgtcatgcacgtgccggtcgaggtcgcccgggcggcgcgcgagacg
gccgccgaactgggcgcggattgctgcatcgcgatcggcggcggttcgacgatcgggctc
ggcaaggccatcgcgctcgaatcgtcgctgccgatcctcgccgtgccgacgacctacgcc
ggctcggagatgacgccgatctacgggctcaccgagggccggttgaagcgcaccgggcgc
gacgcacgcgtgctgccgcggaccgtgatttacgacccgtcgctgacggtgtcgctgccg
ccgggtatttcggcggcgtccggtgtcaatgcgatggcgcatgcggtcgaggcgctctac
gcggaagacgcgaacccggtcatcagcttgatggccgaggaatcgattcgtgcgctcggc
gaagcattgcccgtcgtggtgcgcgatccgcaagatcgcgcaatgcgcagccgcgcgctg
tatggcgcgtggctcgccggcacctgcctcggcgcggtcggcatggcgttgcatcacaag
ctttgtcacacgctcggcggcacgttcaacctgccgcacgcgcagacgcacgcggcgatg
ttgccgcataccgcgcattacaaccacgccgccgcgcccgacgcgctgcgtcgcgtcgca
cgggcgctgggcgggagcgacgcggctgacgccgggccgctgctgttcaggctgaacgcg
caactcggcatcgcgccggcgctcgccgatatcgggatgccgcagcaggggctcgacgaa
gcggccgacctcgcatgcaggaacccgtatgcgaacccgcggccgatcgaacgcgcggcg
attcgcgcgttgcttcagcacgcatgggaaggacgcgcgccgcattga

DBGET integrated database retrieval system