KEGG   Burkholderia cenocepacia J2315: BCAM0471Help
Entry
BCAM0471          CDS       T00771                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09780  uncharacterized protein
Organism
bcj  Burkholderia cenocepacia J2315
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BCAM0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YCII
Motif
Other DBs
NCBI-ProteinID: CAR54328
UniProt: B4EJX3
Position
2:526217..526528
Genome map
AA seq 103 aa AA seqDB search
MARFFAVFATDQPGMRDVRDRMRPIHRTYLRSAAEHGVYVRLGGPTLDPQDDAMNGTLLV
VEADDIHAVMQFIGNDPYVKEGLFSRVEVRPWDWSLGNPEHRV
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtttttttgcggtgtttgccaccgaccagccgggcatgcgtgacgtgcgcgac
cgcatgcggccgattcaccggacatatctgcgctcggcggccgagcatggcgtgtatgtg
cggctcggcggcccgacgctggacccgcaggacgatgcgatgaacggcacgctgctcgtc
gtcgaggcggacgacatccatgcggtgatgcagttcatcggcaacgatccgtatgtgaag
gagggcctgttctcgcgcgtcgaggtgcgcccgtgggactggagcctcggcaaccccgag
cacagggtgtga

DBGET integrated database retrieval system