KEGG   Burkholderia cenocepacia J2315: BCAM0472Help
Entry
BCAM0472          CDS       T00771                                 

Definition
(GenBank) Rieske [2Fe-2S] protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske
Motif
Other DBs
NCBI-ProteinID: CAR54329
UniProt: B4EJX4
Position
2:526532..526867
Genome map
AA seq 111 aa AA seqDB search
MEAKQLCRVADVPDGGARVVDEACIGRPVIVVRRGEQVWAYVNRCPHFSVPLDFVPGNVS
CYRSQVLMCAHHSALFRFDDGVCIDGPCTGAGLETVAVEVDASAWIVFRGA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgaaacagctgtgtcgcgtggccgatgtgcccgacggcggcgcgcgggtcgtc
gacgaagcctgcatcggccgtcccgtcatcgtcgtgcggcgtggcgagcaggtgtgggcg
tacgtgaatcgttgcccgcacttttcggtgccgctcgatttcgtgccgggcaatgtgtcg
tgctaccggtcgcaggtgttgatgtgcgcgcatcacagtgcgttgttccggttcgatgat
ggcgtgtgtatcgacggaccctgcacgggggccgggctggaaaccgtggccgtcgaggtg
gacgcatccgcatggatcgtctttcggggcgcttga

DBGET integrated database retrieval system