KEGG   Burkholderia cenocepacia J2315: BCAM0476aHelp
Entry
BCAM0476a         CDS       T00771                                 

Definition
(GenBank) hypothetical protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAR54334
UniProt: B4EJX9
Position
2:530293..530643
Genome map
AA seq 116 aa AA seqDB search
MSQVSSASRPTVCEDWSHFLPGFTLTHTVHLVSRRNPGIVSTAAAVLEGETATVDRWAIT
RCGDVLEQKIVLGEMTEGQAVRLRERLAALEGVLRTRVEHHFVRAAAAGSTPESSH
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagtttcctccgcttcccgcccgaccgtctgtgaagactggtcgcacttcctt
cccggtttcactttgacgcatacggttcatctcgtttcgagacggaacccgggcatcgtc
tcgaccgcggcggccgtgctcgaaggggaaacggctacggtcgatcggtgggccatcacc
cgctgtggtgacgttctcgagcagaagatcgtgctcggcgaaatgacggaagggcaagcg
gtccggctgcgtgagcggcttgccgcgctggagggggtgctccggactcgggtggagcac
catttcgtgagggcggcggcggccggaagcacgccggagagcagtcactag

DBGET integrated database retrieval system