KEGG   Burkholderia cenocepacia J2315: BCAM0480Help
Entry
BCAM0480          CDS       T00771                                 

Definition
(GenBank) 3-methyl-2-oxobutanoate hydroxymethyltransferase
  KO
K00606  3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00770  Pantothenate and CoA biosynthesis
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
Module
bcj_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BCAM0480
Enzymes [BR:bcj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     BCAM0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_transf
Motif
Other DBs
NCBI-ProteinID: CAR54337
UniProt: B4EJY2
Position
2:complement(533207..534061)
Genome map
AA seq 284 aa AA seqDB search
MSAHTRITRKTVTAIRSTKGIGSLVSLTAYSAPMAKLVDDVADVIIVGDSVGMVLYGMPD
TLRVTLDMMIAHGAAVVRGAAQACVVVDLPFSTFQESPAQAYRSAARLLAETGAQAVKLE
GGCEMTDTIRFLTDRGIPVMAHVGLMPQQANATGGFRAQGMDPRSAAQVFDAACAAERAG
AFGVVIEGTAEALARHLTETLTIPTIGIGASPACDGQVLVTEDMIGAFDAYTPRFVKRYA
DANAVMRDAIRQYAHDVRQRVFPEPAHCFGYGKPLQLADAAPAA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcatacccgcatcacccgcaagaccgtcaccgcgatccgctcgaccaaaggc
atcggcagcctcgtgtcgctgaccgcgtattccgcgccgatggcgaaactcgtcgacgac
gtggccgacgtgatcatcgtcggcgactccgtcggcatggtgctgtacgggatgcccgat
acgctgcgcgtcacgctcgacatgatgattgcacacggggccgccgtcgtgcgcggcgcc
gcgcaggcgtgcgtcgtcgtcgacctgccgttctccacgttccaggaatcacccgcgcag
gcgtatcgctccgccgcgcggctgctcgccgaaaccggcgcgcaggccgtgaagctcgaa
ggcggctgcgagatgaccgacacgatccgcttcctgaccgatcgcggcattccggtgatg
gcacatgtcggcctcatgccgcagcaggccaacgcgacgggcggcttccgtgcgcagggc
atggacccgcgttcggccgcgcaggtgttcgacgccgcgtgcgcggccgagcgggccggc
gcgttcggcgtcgtcatcgaaggcaccgccgaagcgctcgcgcgccacctgaccgaaacg
ctgacgatcccgacgatcggcatcggcgcatcgcccgcgtgcgacgggcaggtgctcgtg
accgaggacatgatcggcgcgttcgatgcgtacacgccgcgcttcgtgaagcgttacgcg
gatgcgaacgcggtgatgcgcgacgcgatccgccagtacgcgcacgacgtgcggcagcgc
gtgtttcccgagcccgcgcattgcttcggatacggcaagccgctgcaactggcggacgcg
gccccggctgcgtga

DBGET integrated database retrieval system