KEGG   Burkholderia cenocepacia J2315: BCAM0486Help
Entry
BCAM0486          CDS       T00771                                 

Definition
(GenBank) NAD dependent epimerase/dehydratase family protein
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00053  Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BCAM0486
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     BCAM0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 NAD_binding_10 RmlD_sub_bind Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-ProteinID: CAR54343
UniProt: B4EJY8
Position
2:539838..540674
Genome map
AA seq 278 aa AA seqDB search
MNASSTAARKPFGRLLLTGAAGNLGRQLRGALADWADVVRVSDIAALDDAAAHEEIRVVD
LADRPAVMQLVDGVDAIVHLGGISVDAPFDDLVGANITGTYNLYEAARKHGVKRVVFASS
NHAIGFHPVTEVLDADAPLRPDSLYGVTKCFGESLSRYYFDRFGIETVCLRIGSSFEVPK
NPRMLVTFLSYRDFIELVRCSLLTNRVGHAIVYGASDNPVKWWDNTKVGFLGFRPRDSSE
QFAGLFPVTAPTAEYDDPAQRFQGGGFVVGEPMERKAS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcctcatccaccgccgcgcgcaaaccgttcggccgcctgctgctgacgggcgcg
gccggcaacctcggccgccagttgcgcggcgcgctcgccgactgggccgacgtcgtgcgc
gtcagcgacatcgcggcgctggacgacgcggccgcgcatgaagaaatccgcgtggtcgac
ctggccgaccggccggccgtgatgcagctcgtcgacggcgtggacgcgatcgtccacctc
ggcggcatttcggtcgatgcgccgttcgacgatctggtcggcgcgaacatcaccggcacg
tacaacctgtacgaagccgcgcgcaagcacggcgtaaagcgcgtcgtgttcgcgagctcg
aaccatgcgatcggtttccatccggtcacggaagtgctcgacgccgatgcgccgctgcgc
cccgacagcctgtacggcgtgacgaagtgcttcggcgaatcgctgtcgaggtattacttc
gaccgcttcgggatcgaaaccgtatgtctgcggatcggctcgtcgttcgaggtgccgaag
aatccgcggatgctcgtcacgttcctcagctatcgcgatttcatcgagctcgtgcgctgc
tcgctgctgacgaaccgcgtcgggcacgcgatcgtctacggcgcgtcggacaacccggtg
aagtggtgggacaacacgaaggtcggtttcctcggcttccgtccgcgcgacagctccgaa
cagttcgccgggttgttcccggtgacggcgccgaccgccgagtacgacgatcccgcacag
cggttccagggcggtggattcgtcgtcggcgagccgatggagcggaaggcgtcgtaa

DBGET integrated database retrieval system