KEGG   Burkholderia cenocepacia J2315: BCAM0488Help
Entry
BCAM0488          CDS       T00771                                 

Definition
(GenBank) putative exported protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAR54345
UniProt: B4EJZ0
Position
2:complement(541156..541851)
Genome map
AA seq 231 aa AA seqDB search
MTIPRIKGFFIAVLLTFGIGSAFASTCDDTHSSIRCPDTSDLPADIVAQLPAGYEALDAA
SGRLTDGTRNGYVVVAHQPGDSMQTPSLRPLLIFLQGANGRYRLAARNDTVIMKADEGGM
GDPYLDGVAENALTIEPRMFTVEQGVFAGHNHWRDRVTFRYDVAHRTWLFHREVFRNWRF
NYEQDGDALKADPVRVTRANAAKAVSFEAWRPSYWCDSAERRNNDPACRKH
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcccccgtatcaaaggatttttcatcgccgtactgctgacgttcggcatcggc
agtgccttcgcgtcgacgtgcgacgacacgcattcgtcgatccgttgcccggacacctcc
gatctgccggccgacatcgtcgcgcaactgcccgccggttacgaagcgctggatgccgca
tcggggcgcctgaccgacggcacgcgcaacggttacgtcgtcgtcgcgcatcagcccggc
gattcgatgcagacgccgtcgctgcgtccgctgctgatcttcctgcagggtgcgaacgga
cgctaccggctggcggcccgcaacgacaccgtgatcatgaaagccgacgaaggcggcatg
ggcgacccgtatctcgatggcgtcgccgagaacgcgctcacgatcgagcctcgcatgttc
accgtcgaacagggcgtattcgcaggccataaccactggcgcgaccgcgtgacgtttcgc
tatgacgtcgcgcatcgcacgtggctgttccatcgcgaagtgttccggaactggcgattc
aactacgaacaggacggcgatgcgctgaaggccgacccggtacgcgtcacgcgtgcgaat
gcggcaaaggccgtttcgttcgaagcgtggcggccgagttactggtgcgattccgccgag
cggcgcaacaacgatccggcttgccgcaagcattga

DBGET integrated database retrieval system