KEGG   Burkholderia cenocepacia J2315: BCAM0489Help
Entry
BCAM0489          CDS       T00771                                 

Definition
(GenBank) MerR family regulatory protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR_1 MerR-DNA-bind MerR HpaB
Motif
Other DBs
NCBI-ProteinID: CAR54346
UniProt: B4EJZ1
Position
2:complement(541952..542422)
Genome map
AA seq 156 aa AA seqDB search
MEPIMKIGELAKASGLAASRIRFYEASGLLEPARRQANGYREYGPEALTRLAIIDRAQRA
GFSLDEIRAVLPPDLGAWPHDELLVALRHKVDEIALLERRLAQNRQHLETLIDEIENKPE
GEDCAGAAQRMLDRLCEQASQPLESAPVVRPARKRA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
ttggagcccatcatgaaaatcggcgaactggcgaaggcgagcggcctcgcggcgtcgcgc
atccgcttctacgaagcgagcggcctgctcgaaccggcccgccgccaggcgaacggctat
cgggaatacgggccggaagcgttgacgcggctcgcgatcatcgatcgcgcgcagcgcgca
ggcttctcgctcgacgagattcgcgcggtgctgccgcccgatctcggcgcatggccgcac
gacgaactgctggtcgcgctgcggcacaaggtcgacgaaatcgcgctgctcgaacggcgt
ctcgcgcagaaccggcagcacctcgagacgctgatcgacgaaatcgagaacaagcccgaa
ggcgaggattgcgcgggcgccgcgcagcggatgctcgaccggctgtgcgagcaggccagc
cagccgctggagtccgcccctgtggtgcggccggcgcgcaagcgcgcgtga

DBGET integrated database retrieval system