KEGG   Burkholderia cenocepacia J2315: BCAM0490Help
Entry
BCAM0490          CDS       T00771                                 

Definition
(GenBank) putative NADH oxidoreductase
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN His_biosynth MR_MLE_C TMP-TENI
Motif
Other DBs
NCBI-ProteinID: CAR54347
UniProt: B4EJZ2
Position
2:542479..543720
Genome map
AA seq 413 aa AA seqDB search
MSTMNLFAPLTLPNGAVIPNRLAKAAMEENMADADHAPSDALLRLYQAWADGQVGLILTG
NVMVDGRAMTGPNGVVLESDAHLDRFRRWAQIARSGGAHVWMQINHPGRQMQAALGQTTL
APSAVPLALGALSKQFPVPKEMTAADIADVQQRFVRAAQLAEQSGFTGVQVHAAHGYLLS
QFLSPLTNRRQDQWGGSIENRARLLLDIVKAVRATVSPAFVVAVKLNSADFQRGGFSADD
AKRVVELLNPLGVDLVELSGGSYEVPAMQGEARDGRTLAREAYFLEFARDITAVARMPLM
VTGGIRRRAVAEQVVNSGVAMVGIATALSIDPNLPRDWRAGKDSAPVLQPIRWKNKALGA
LANMAVVKFQLTRLSEGRRTHPRVSPLRALVRQQLAAQCQTRRYRKWMAGPRA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaccatgaatctgtttgcgccgctcacactgcccaacggggcggtgattccgaac
cgtctggccaaggccgcgatggaagaaaacatggccgatgcggaccacgcgccgtccgac
gcgttgctgcgcctgtaccaggcgtgggccgacggtcaggtcggcctgatcctgaccggc
aacgtgatggtggacggccgcgcgatgacggggccgaacggcgtcgtgctcgaaagcgac
gcgcatctcgaccggttccgccgctgggcgcagatcgcgcgctcgggcggcgcgcacgta
tggatgcagatcaatcacccggggcgccagatgcaggcggcgctgggccagacgacgctc
gcgccgtcggccgtgccgctcgcgctcggcgcgctgtcgaagcagtttccggtgccgaag
gagatgacggcggccgacatcgccgacgtgcagcagcgcttcgtgcgcgccgcgcagctc
gcggagcaaagcggcttcaccggcgtgcaggtgcacgcggcgcacggctatctgctgagc
cagttcctgtcgccgctgaccaatcgccgccaggatcagtggggcggcagcatcgagaat
cgcgcgcgcctgctgctcgatatcgtgaaggcggtgcgcgcgacggtgtcgccggccttc
gttgtcgcggtgaagctgaactcggccgatttccagcgcggcggcttcagcgcggacgac
gcgaagcgggtggtcgaactgctgaatccgctcggcgtcgatctcgtcgaactgtcgggc
ggcagctatgaagtgccggcgatgcagggcgaggcgcgcgacgggcgcacgctcgcgcgc
gaagcgtacttcctcgaattcgcgcgcgacatcacggccgtcgcgcggatgccgctgatg
gtcacgggcggcatccggcgccgtgcggtggccgagcaggtagtgaacagcggtgtcgcg
atggtcggtatcgcgaccgcactgtcgatcgacccgaacctgccgcgcgactggcgcgcg
ggcaaggacagcgcgccggtgctgcagccgatccgctggaagaacaaggcgttgggcgcg
ctggcgaacatggccgtcgtcaagttccagctcacgcggctcagcgaagggcgtcgcacg
catcctcgggtgtcgccgctgcgcgcgctggtgcgccagcaactggccgcgcagtgccag
acgcggcgctaccggaagtggatggccggcccgcgcgcgtga

DBGET integrated database retrieval system