KEGG   Burkholderia cenocepacia J2315: BCAM0491Help
Entry
BCAM0491          CDS       T00771                                 

Definition
(GenBank) TonB-dependent receptor
  KO
K02014  iron complex outermembrane recepter protein
Organism
bcj  Burkholderia cenocepacia J2315
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcj02000]
    BCAM0491
Transporters [BR:bcj02000]
 Other Transporters
  Pores ion channels [TC:1]
   BCAM0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec Plug Tcf25
Motif
Other DBs
NCBI-ProteinID: CAR54348
UniProt: B4EJZ3
Position
2:complement(543815..545938)
Genome map
AA seq 707 aa AA seqDB search
MKFKSMLPAAVLAALSPAGQAHAQERGVDGAGATLAPILVDAQKAPALTQPLDTGSHLGL
SPLETPASVEQINRATLDTRGDNSIIDAVSRAAGISASPHPGNGNSELAARGFVGASSVT
QLYDGMRPYGAIGVTFPFDTWSVDHIDVLRGPASVIYGEGAIGGVVNIVPKKPTRTPIRN
ELQVGGGTEGTARAAFGSGGAINDKLSYRFDVSGNRSSNWVDRGDSRNLSVSGALRYDVT
PDLYVTASYAQGFMHPMQYFGVPLVDGARDRALDKKNYNVGDADIAFRDSWATVSANWQP
SDALNVTSTLYRMKSNRHWKDAEYYTYLPSSAQARRSSYTEIFHDQEQYGNVTTATVGSA
LFGMRNTFSAGVEFNHTTFQHDNNSPYAGTSTVDPFNVDPGSFLNTAGTFPKYRSQSNQY
ALFAENRLEITPRWSVIGGLRYDHASVNRDDLVNGGAFTKVFANTGWRLGTVYDVRPGLA
VYGQYSVAADPVSSLLSLNASKANFTLATGRQIEIGVKQSFLDGKAEWTLAAYRIVKRNL
LTADPVNPNQSIQVGQQSSRGLEATVGAEIAKDWRVDANVSILRAKYDDFQQSSGGTTVS
RAGNVPVSVPQRLANLWISWRFAPDWTGIAGVKYVGKRFADTANQLVMPSYTTVDLGLAW
KPRKDTTITARAYNVFNRRYVQSAYYNETQYLLGNDRRVEVLANYRF
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcaaatcgatgctgcccgccgccgtgctcgcggcgctctcgccggccgggcag
gcccacgcacaggaacgcggcgtcgacggtgccggcgccacgctcgcgccgattctcgtc
gacgcgcagaaggcgcccgccctgacgcaaccgctcgacaccggcagccatctcgggctg
tcgccgctcgaaacgcccgcgagcgtcgagcagatcaaccgcgcgacgctggacacgcgc
ggcgacaactcgatcatcgacgccgtgagccgcgccgccggcatcagcgcatcgccgcat
cccggcaacggcaactcggagctcgccgcgcgcggcttcgtcggtgcatcgtcggtcacg
cagctctacgacggcatgcgcccgtacggcgcgatcggcgtcacgttcccgttcgacacg
tggtcagtcgaccacatcgacgtgttgcgcggccccgcttcggtgatctacggcgaaggc
gcgatcggcggcgtggtcaacatcgtgccgaagaagccgacgcgcacgccgatccgcaac
gagctgcaggtcggcggcggcaccgaaggcacggcgcgcgccgcgttcggcagcggcggc
gcgatcaacgacaagctgtcgtaccgcttcgacgtcagcggcaaccgctcgtcgaactgg
gtcgatcgcggcgactcgcgcaacctgtcggtgtccggcgcgctgcgctacgacgtgacg
cccgacctgtacgtgacggcgtcgtatgcgcagggcttcatgcatccgatgcagtatttc
ggtgtgccgctcgtcgacggtgcgcgcgatcgcgcgctcgacaagaaaaactacaacgtc
ggcgacgccgacatcgcgttccgcgacagctgggccaccgtctcggcgaactggcagccg
agcgacgcgctgaacgtgacgagcacgctgtaccggatgaagagcaaccgtcactggaag
gacgccgagtactacacgtacctgccgtcgagcgcgcaggcgcggcgcagcagctacacg
gagatctttcacgaccaggaacaatacggcaacgtgacgacggccaccgtcggcagcgcg
ctgttcgggatgcgcaacacgttttcggcgggcgtcgagttcaaccacacgacgttccag
cacgacaacaattcgccgtatgcgggcacgtcgacggtcgatccgttcaacgtcgatccg
ggcagtttcctcaacacggccggcacgtttccgaagtaccgtagccagtcgaaccagtac
gcgctgttcgcggagaaccggctcgagatcacgccgcgctggtcggtgatcggcgggctg
cgctacgaccatgcgagcgtgaaccgcgacgatctcgtgaacggcggcgcgttcacgaag
gtattcgcgaacacgggctggcgcctcggcaccgtgtacgacgtgcggcccggcctcgcc
gtatacggccagtattcggtcgcggccgatccggtcagctcgctgctgtcgctgaatgcg
tcgaaggccaacttcacgctcgcgaccggccggcagatcgagatcggcgtgaagcagtcg
ttcctcgacggcaaggccgaatggacgctcgccgcgtaccggatcgtgaagcgtaacctc
ctgacggccgacccggtgaatccgaaccagtcgatccaggtcggccagcagtcatcgcgc
gggctggaggcgacggtcggcgcggagatcgcgaaggactggcgcgtcgatgcgaacgtg
tcgatcctgcgcgcgaaatacgacgatttccagcagtcgtccggcggcacgaccgtgtcg
cgcgcgggcaacgtgccggtgtcggtgccgcagcggctcgcgaacctgtggataagctgg
cgcttcgcgccggactggaccggcatcgcgggcgtcaagtacgtcggcaagcggttcgcc
gataccgcgaaccagctcgtgatgccgtcgtacacgaccgtcgacctcggcctcgcgtgg
aaaccgcgcaaggacacgacgatcaccgcccgcgcgtacaacgtgttcaatcgccgctac
gtgcagtccgcgtactacaacgagacgcagtatctgctcggcaacgaccggcgcgtcgag
gtgctggcgaactaccggttctga

DBGET integrated database retrieval system