KEGG   Burkholderia cenocepacia J2315: BCAM0493Help
Entry
BCAM0493          CDS       T00771                                 

Definition
(GenBank) putative membrane protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2946
Motif
Other DBs
NCBI-ProteinID: CAR54350
UniProt: B4EJZ5
Position
2:complement(547691..548176)
Genome map
AA seq 161 aa AA seqDB search
MNALRRFLLRPGVARQWLWGFLLVTLLSRALMSGAVMLDPDGPDAGSVVLCSGQGPLIVT
AAALAARFDASAPITPANDALALVDALKHDAHADKAASSGNGDSLCAFGAALFTALASFV
LLVLLFPAAVPRRFRVHFDSLPFVRSLFDDRPPSRAPPRFC
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacttcgccgcttcctgctccggccaggcgtcgcacgacagtggctgtggggg
ttcctcctcgtgacgctgctgtcccgcgcgctgatgtcgggcgccgtgatgctcgatccg
gacggtccggatgcgggctcggtggtgctgtgttcaggccagggcccgctgatcgtcacc
gccgccgcgctggccgcccgcttcgacgcgagcgcgccgatcacgccggccaacgacgcg
ctggcgctcgtcgatgcactgaagcatgacgcgcacgccgacaaggcggcgtcttccggc
aacggcgacagcctgtgcgcattcggcgccgcgctgttcaccgcgctcgcatcgttcgtg
ctgctggtgctgctgtttcccgcggcggttccccgacgcttccgcgttcacttcgacagt
cttcctttcgtgcgatcgctattcgacgatcgcccgccctcccgcgcccctcctcggttc
tgctga

DBGET integrated database retrieval system