KEGG   Burkholderia cenocepacia J2315: BCAM0497Help
Entry
BCAM0497          CDS       T00771                                 

Definition
(GenBank) putative lipoprotein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tli4_C Tli4_N
Motif
Other DBs
NCBI-ProteinID: CAR54355
UniProt: B4EK00
Position
2:550332..551369
Genome map
AA seq 345 aa AA seqDB search
MVRLLRWFGVLAGLCACTSVFSADPATSNPLLSKVRPWCIGRLVFDRPVSSEISSQRYAY
RGEQLLTTHEVPPDAYQAAIAAREQVMRTRLRANPVEMDRKTRHAWLEMAFSPVPDSRVF
VFNEAAAKSVTLPFDTEGYLYANRTLVRTTGSIGADALDRVEGVYDDTFRRIRMRDNWVV
PTEPGFCFDGGIVTGSSTYPEEVRQSFALMPGRPALLVIQSRNAFGDDREQPFSRTLPAL
RAKFDRLPGSHRLLREGKRSIAGMDAEEVLFELRDGAVTAYRFYLLAPGNAATLAQPHTA
IEMLLGVAGQSDLPPAQATSPVDEARALQAWDTLLNGLHARPGAI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtcttttgcgctggttcggtgtgctggcgggactgtgtgcctgcacttcggtg
ttttccgccgatccggcgacaagcaatccgctgctgtccaaagtacgtccgtggtgtatc
ggccgcctggtgttcgatcggccggtttcgagcgagatctcgagtcagcgttacgcgtac
cgcggggagcaactgctcacgacgcacgaggtgccgccggatgcctaccaggccgccatc
gccgctcgcgagcaggtgatgcgtacccggctgcgcgcgaatccggtcgagatggatcgg
aagacccgtcacgcgtggctggaaatggccttttcccccgtaccggattcgcgtgttttc
gtcttcaacgaagcggcggcgaaatccgtcacattgccgttcgataccgaaggctatctg
tacgcgaaccgcacgctcgtccgcacgacgggcagcatcggcgccgatgcgctggatcgt
gtcgagggcgtctatgacgacacgttccggcgcatccggatgcgcgacaactgggtcgta
ccgaccgaaccgggcttctgcttcgacggcgggattgtgaccggatcgtccacctacccc
gaagaagtcaggcaatcgttcgcgttgatgccgggccgaccggcgctgctcgtgatccag
tcgcgcaatgccttcggcgacgatcgcgagcagccgttcagccgtacgctgcccgcgttg
cgcgcgaaattcgatcgcctgcccggaagccatcgtctcctgcgcgaggggaaacggtcg
attgccggcatggatgccgaggaagtgctgttcgagctccgggacggcgccgtcacggct
tatcgcttctacctgctcgcgccgggcaatgccgccacgcttgcgcagccgcataccgcg
atcgagatgctgctgggcgtggccgggcagagcgacttgccgccggcgcaggccacctcg
ccggtcgatgaggcgcgcgcgctgcaggcatgggacacgctgctgaacggcctgcacgcg
cgaccgggcgcgatctga

DBGET integrated database retrieval system