KEGG   Burkholderia cenocepacia J2315: BCAM0499Help
Entry
BCAM0499          CDS       T00771                                 

Definition
(GenBank) TonB-dependent receptor
  KO
K16090  catecholate siderophore receptor
Organism
bcj  Burkholderia cenocepacia J2315
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcj02000]
    BCAM0499
Transporters [BR:bcj02000]
 Other Transporters
  Pores ion channels [TC:1]
   BCAM0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec Plug
Motif
Other DBs
NCBI-ProteinID: CAR54357
UniProt: B4EK02
Position
2:553828..556026
Genome map
AA seq 732 aa AA seqDB search
MSRLFSCRLRWPFAVFFTTSTFTMKLHTSACHALLIATSLAGARTSFAQASDAAATLPAI
SVNAAAEHGSYDGGHSRAATKTDMSLMDVPQTVNVVPHAVIEDQNATSLQDALRNVPGVG
FSVGDGQRDQITIRGFNSITDQYVDGIRDDALYYRDLSNVDRVEVLKGPAAVLYGRGSAG
GIVNRVLKRPQANPVNDVGVTLGTRGERRGEFDLGWNPNDAARFRITGAAENSNSFRDRF
QLNRQAIAPSAQFKLDRDTVLNVEFDYLHDRRTSDQGLPAYRGRPVDVPINTYYGSADGG
NSSYNDISAKSATVSLDHRFNDSLSFHGAIRAYDFSLERKNYVTYEPIKTAAHPVVTLDQ
STRQRTDHGIDGLFELTQKTSLFGMRHELLYGLELSQQQKFDTIYSVTKVATYDLFNPQP
VVLPGVPGGTRAKTNASTVVGLAGVYAQDLISLTEHWKVLAGLRFDYLNQIRHDYTSSNV
NLDRTDHAWSPRVGLIYEPLDWLTLYGSFSQSFSPLADTLISSGAFSNGAALAPQKTTAY
EVGSRFDLGGKATASVALFDMRQTNQQIGDPANPGYALPIGTQHVRGMELGFTGEIAPKW
SVYAGYAYLNGTVDGSAQSTAAGLAVSSNTPGLMPRHSANLWLKRELPYGFYAAAGMQFQ
SARYTSASDLVTLPSFTVFNLGAGYRSKKVDVTLTLDNLFDRRYFIAAHGNADLYNMPGD
PRTLTATVKWHM
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcacggcttttttcgtgccgcttgcgctggccgttcgccgttttcttcaccacctct
acgttcacgatgaaactccacacgagcgcgtgccatgcgcttctgatcgccacgtcgctg
gccggcgcccgcacttcgtttgcgcaggcgagcgatgccgcggcgaccctgcccgcgatt
tccgtcaacgcggccgccgagcatgggtcgtacgacggcggccattcgcgcgcggcgacc
aagaccgacatgtcgctgatggacgtgccgcaaaccgtgaacgtcgtgccgcacgcggtg
atcgaggatcagaacgcgacgtcgctgcaggacgcgctgcgcaacgtgccgggcgtcggc
ttctcggtcggcgacggccagcgcgaccagatcacgatccgcggcttcaacagcatcacg
gaccagtacgtcgacggcattcgcgacgacgcgctgtactaccgcgacctgtcgaacgtc
gatcgcgtcgaggtgctgaaggggccggcggccgtgctgtacgggcgcggctcggcgggc
ggcatcgtgaatcgcgtgctgaagcggccgcaggcgaacccggtgaacgacgtgggcgtg
acgctcggcacgcgcggcgagcggcgcggcgagttcgatctcggctggaacccgaacgac
gcggcgcgctttcgcatcaccggcgcggccgagaattcgaacagcttccgcgaccggttc
cagctcaaccggcaggcgatcgcgccgtccgcgcagttcaagctcgaccgcgacacggtg
ctgaacgtcgaattcgactacctgcacgaccgccgcacgtccgatcaggggttgcccgcg
tatcgcggccggccggtcgacgtgccgatcaacacgtactacgggtcggccgacggcggg
aacagttcgtacaacgacatctccgcgaaaagcgcgacggtgtcgctcgatcaccgcttc
aacgattcgctgtcgttccacggcgcgatccgcgcgtacgacttctcgctcgagcggaag
aactacgtgacgtacgagccgatcaagaccgccgcgcacccggtcgtcacgctcgatcag
tcgacgcgccagcgcaccgatcacggcatcgacgggctgttcgaactcacgcagaagacc
tcgctgttcggcatgcgtcacgagctgctgtacgggctggagctgtcgcagcagcagaag
ttcgacacgatctacagcgtgacgaaggtcgcgacctacgatctgttcaatccgcagccg
gtcgtcctgcccggcgtgccgggcggcacgcgtgcgaagacgaacgcgtcgaccgtcgtc
gggctcgcgggcgtctatgcgcaggacctgatctcgctgaccgaacactggaaggtgctc
gccggcctgcgcttcgattacctgaaccagatccgccacgactacacgtcgtcgaacgtc
aatctcgaccgcaccgatcatgcatggagcccgcgcgtcggcctgatctacgaaccgctc
gactggctcacgctgtacgggtcgttcagccagtcgttctcgccgctggccgacacgctg
atcagttccggcgcgttctcgaacggcgccgcgctcgcgccgcagaagaccaccgcgtat
gaagtgggctcgcgcttcgaccttggcggcaaggcgacggccagcgtcgcgctgttcgac
atgcgccagaccaaccagcagatcggcgacccggcgaatcccggctatgccctgccgatc
ggcacgcagcacgtgcgcgggatggagctcggcttcaccggcgagatcgcgccgaagtgg
tcggtgtatgcgggttacgcgtacctgaacggcacggtggacgggtccgcgcaatcgacg
gcggccggcctggcggtgtcgagcaacacgccggggctgatgccgcgccacagcgcgaac
ctgtggctcaagcgcgagctgccgtacggcttctatgcggcggccggcatgcagttccag
tccgcgcgctatacgtcggcgagcgatctcgtcacgctgccgtcgttcacggtgttcaac
ctgggcgccggctatcgcagcaagaaggtcgacgtgacgctcacgctcgacaacctgttc
gatcgacgctacttcatcgccgcgcacggcaacgcggacctgtacaacatgccgggcgat
ccgcgcacgctgaccgccacggtgaagtggcacatgtaa

DBGET integrated database retrieval system