KEGG   Burkholderia cenocepacia J2315: BCAM0500Help
Entry
BCAM0500          CDS       T00771                                 

Definition
(GenBank) putative exported protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAR54358
UniProt: B4EK03
Position
2:556114..556575
Genome map
AA seq 153 aa AA seqDB search
MTARARALLLSLLACGPVAAGAQTIPADAEPGCHAVHVDRTITLSGRYALDYGDESIGPD
VGFEEDDASARHLPDHPQRAGVIVFTNQSDARRRLRLPAAQPRGVCRFDGRATLVIRDLE
TACPGLETPDRARLVKVVSADAPARHACGATAR
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgcgcccgcgcgctgcttttatcgttgctggcgtgcggcccggtcgcggcc
ggtgcgcagacgattcccgcggatgccgagccgggttgccatgccgtgcatgtcgaccgg
acgatcacgctgtcggggcgttacgcgctcgactacggcgacgaatcgatcgggccggac
gtggggttcgaagaggacgacgcgtcggcgcggcacttgcctgatcacccgcagcgcgca
ggcgtgatcgttttcacgaaccagtccgacgcgcggcgccggctgcggctgcccgccgcg
cagccgcgcggcgtgtgccggttcgacgggcgtgcgacgctcgtgatccgcgatctggag
accgcgtgcccggggctggaaacgcccgatcgtgcgcggctggtgaaggtcgtgtcagcc
gacgcgccggcgcggcacgcatgcggcgccaccgcgcggtga

DBGET integrated database retrieval system