KEGG   Burkholderia cenocepacia J2315: BCAM0504Help
Entry
BCAM0504          CDS       T00771                                 

Definition
(GenBank) CsbD-like protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CsbD
Motif
Other DBs
NCBI-ProteinID: CAR54361
UniProt: B4EK06
Position
2:complement(559036..559233)
Genome map
AA seq 65 aa AA seqDB search
MNEDKIKGQWKQLTGKLKAKWGKLTDDDLQVAEGNRDYLAGKIQERYGIARDEAEKQLKE
FDREL
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagacaagatcaagggccagtggaagcagctcaccggcaagctgaaggccaag
tggggcaagctgaccgacgacgatcttcaggtcgcggaaggcaatcgcgactatctggcc
ggcaagatccaggagcgttacgggatcgcccgcgacgaagccgagaagcagttgaaggaa
ttcgaccgcgagctgtaa

DBGET integrated database retrieval system