KEGG   Burkholderia cenocepacia J2315: BCAM0514Help
Entry
BCAM0514          CDS       T00771                                 

Definition
(GenBank) TetR family regulatory protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N
Motif
Other DBs
NCBI-ProteinID: CAR54371
UniProt: B4EK16
Position
2:complement(568970..569545)
Genome map
AA seq 191 aa AA seqDB search
MTNDASSNSRERILAAATRLTQTHGYGGLNYRDLANEVGIKAASIYHHFESKADLGAAVA
RRYREDSAAALDDMLARSRDPLDCLRRYPDTFRKALETGNRLCLCSFMAAETDDLPEVVM
KEVLAFADVNVAWLSKVLSAAAVVGARESKQRARAIFAAIAGAQLIARSRADLSLYDALI
DSYRKAGLLPA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaacgacgcgagctcgaactcgagagaaagaattctggcggccgccacgcggctc
acgcagacgcacggttacggcggcttgaactatcgggatctcgccaacgaggtggggatc
aaggccgcgagcatctaccaccattttgaaagcaaggccgatctcggcgcggcggtagcg
aggcgttatcgggaagattcagcggcggcgctggacgacatgctggcccgatcgcgcgat
ccgctggattgcctgcgtcgctatccggatacctttcgcaaggcgctcgagaccggcaac
cgcctgtgcctgtgcagcttcatggccgccgaaaccgacgacctgccggaagtcgtgatg
aaggaagtgctggccttcgccgacgtgaacgtggcgtggttgagcaaggtgctgtccgcg
gcggcagtggtcggcgctcgggagagcaaacagcgggcgcgggccatcttcgccgccatc
gccggcgctcagctcatcgcgcgcagccgtgccgatctctcgctctacgacgcgctgatc
gacagttatcgtaaggcaggccttttgcccgcgtag

DBGET integrated database retrieval system