KEGG   Burkholderia cenocepacia J2315: BCAM0515Help
Entry
BCAM0515          CDS       T00771                                 

Definition
(GenBank) glutathione S-transferase
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: CAR54372
UniProt: B4EK17
Position
2:569691..570383
Genome map
AA seq 230 aa AA seqDB search
MTSRTANFDVARLPLMKVYDFPTGPYPTRVRIALAEKGLQSRVEFVMVDLYKGEHKKPEF
IAGKNYSGTLPVLELDDGTCIAECTAITEYLDALDGAPTLTGSTPREKGIIHMMSKRAEL
ELLDAVSVYFHHGTPGLGPDVETYQNPEWGFRQRDKALRGMRYFDAVLQSRPYVAGATFS
MADITVIGGLIFAMLVKLPVPEECEALRAWYARMLERESVRSQPVFAALT
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccgtaccgccaatttcgacgtagcccgactgcccctgatgaaggtctacgat
ttcccgaccgggccctatccgacccgcgtgcgcatcgcgctggccgaaaaggggctgcaa
tcgcgcgtcgagttcgtgatggtcgatctttacaagggcgagcataaaaagcccgagttc
atcgccggcaagaattattcgggtacgttgccggtgctggagctcgacgacggaacctgt
atcgccgagtgcacggccattaccgaatacctcgacgcactcgatggcgcgcccacgctc
accggcagcacgcctcgcgaaaagggcatcattcacatgatgagcaaacgcgccgagctg
gagctgctcgacgccgtcagcgtctatttccatcacggcacgccggggctcggccccgac
gtcgagacgtatcaaaacccggagtgggggttccgccagcgcgacaaggcgctgaggggc
atgcgctacttcgatgccgttctgcaaagccggccgtatgtcgcgggtgcgacgttctcg
atggccgacatcaccgtcatcggcggtctgatctttgcgatgctcgtgaagctgccggtg
cctgaggagtgcgaagcgcttcgcgcctggtacgcgcgcatgctggaacgtgagagcgtc
aggagccagccggtgttcgccgccttgacctga

DBGET integrated database retrieval system