KEGG   Burkholderia cenocepacia J2315: BCAM0517Help
Entry
BCAM0517          CDS       T00771                                 

Definition
(GenBank) putative exported protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAR54374
UniProt: B4EK19
Position
2:570916..571596
Genome map
AA seq 226 aa AA seqDB search
MMRRIGKTLAVISSMAVVGIAHVQAASGETAFPRFTQSEGKLDADGLPLSGVKLCVLPDR
APCFEMPPKLVPGSAKELYQFGLNPRSERLPIASGGSWVFFSGMFSGGGSGMLERVAVLR
VGANGKIENLMPIVTETEMADRAMWSVPEVSPYPLFVRADYVWGKGEDHFGKHVFDVDAW
TFDPAANRYAKRFSYRTSKRYDRGEGADRVLSAERPEILRRLAAAQ
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgccggatcggtaaaacgctcgcggtgatctcgagcatggcggtcgtcggcatc
gcccacgttcaagcagcctccggcgaaactgcattcccgcgtttcacgcaatccgaaggc
aagctcgatgccgacgggcttccgctgtcgggcgtgaagctctgcgtgctgcccgaccgt
gcgccgtgcttcgagatgccgccgaagcttgtccccggttccgccaaggagctgtaccag
ttcggtctgaatccacgctccgaacggctgccgattgcgtcgggcggctcgtgggtgttt
ttctcgggaatgttctcgggtggcggcagcggaatgctggaacgcgtcgctgtcctgcgt
gtcggcgcgaatggcaagatcgagaacctgatgccgatcgtcaccgaaaccgagatggcc
gatcgtgcgatgtggagcgtgccagaggtgtcgccgtatccgctgttcgtccgggccgac
tacgtgtggggcaagggcgaggatcatttcggcaagcacgtcttcgacgtcgacgcatgg
acgttcgatcccgccgccaatcgatacgcgaagcgcttttcctaccggacgagcaaacgc
tatgacagaggcgaaggcgcggatcgcgtgctgagtgccgagcgtccggaaatcctgcgg
cgcctcgccgccgcccaatag

DBGET integrated database retrieval system