KEGG   Burkholderia cenocepacia J2315: BCAM0522Help
Entry
BCAM0522          CDS       T00771                                 

Definition
(GenBank) putative integrase
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve HTH_23 HTH_38 HTH_7 HTH_3 Sigma70_r4_2 HTH_24 GerE HTH_29 HTH_Tnp_Tc3_1 HTH_11 HTH_28 HTH_31 HTH_IclR rve_3 TnsD HTH_17 HTH_8 RepB Phage_NinH Sigma70_ECF HTH_Crp_2 HTH_26 HTH_50 CENP-B_N HTH_AsnC-type HTH_36 HTH_20 KorB HTH_22 NUMOD1 HTH_10 Sigma70_r4 Terminase_5 HTH_19 HTH_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: CAR54379
UniProt: B4E5J1
Position
2:complement(577687..578715)
Genome map
AA seq 342 aa AA seqDB search
MLQKEQWMQIHVLKAQGVSEREIARRLGISRNTVARYLSAEDVPRYKPREPRPTKLGAFE
AYILDRMSAAAPEIIAAPALLRELRARGYEGQLRSLQAFMNAHKSVPKPDPVVRFETEPG
RQMQCDFVVFRRGTDPLYAFTATLGFSRWRWARFTTDERAETLVACHHALFEALGGVPRE
ILYDNAKTIVVERDAYGDGQHRWHAGMLDLAKRYGFLPRLCQPYRAQTKGKVERFHRYLR
GNFYVPLASRLKQSGLMLDAVTANVEVSKWLRDVANQRVHPVTGLAPAILLEQRERACLR
DMPGYAVPRLPARAVARPRVDPAMSIQHPLSVYQQLLTEVRA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgctccagaaggaacagtggatgcaaatccatgtgctcaaagcccaaggcgtatcggag
cgcgagatcgcgcggcgcctgggtatttctcgcaacacggtggcgcggtacctgtcggcc
gaggacgtgccgcgctacaagccgcgtgaaccgcggccaaccaagctcggagcgttcgag
gcgtacatcctcgatcgcatgagcgccgcagcacccgagatcatcgctgcgccggcgctg
ctgcgcgagctgcgtgcgcgcggctacgagggccaactgcgaagcctgcaggctttcatg
aacgcgcataagtccgtgcccaagccagacccggtcgtgaggttcgagaccgagcctggc
cggcagatgcagtgcgatttcgtggtcttccgccgaggcaccgacccgctttacgccttc
accgccacgctcgggtttagtcggtggcgctgggcacgcttcaccaccgatgaacgcgcc
gagacgctggtcgcctgtcatcatgcgctgttcgaagccttgggtggcgttcctcgcgag
atcctttacgacaacgccaagactatcgttgtcgagcgcgatgcatatggcgacggtcaa
caccgctggcacgccggcatgctcgatctggccaagcggtacggcttcctacccagactg
tgccaaccgtaccgcgcgcaaaccaaaggcaaggtcgagcgattccaccgctacctgcgt
ggcaatttctatgtgccgctggcgagccggctcaagcaatccggcttgatgctcgatgcc
gtgactgcgaacgtcgaggtgagtaaatggctgcgcgacgtggctaaccagcgagtgcat
ccggttacagggctggcacccgcgattctgttggagcaacgcgaacgggcttgcttgcgc
gatatgccgggttacgcggtgccccgattgccggctcgtgccgtcgctcggccacgcgtt
gatccagcaatgtcgatccagcacccgttgtccgtctaccagcaattactgaccgaggtg
cgcgcatga

DBGET integrated database retrieval system