KEGG   Burkholderia cenocepacia J2315: BCAM0527Help
Entry
BCAM0527          CDS       T00771                                 

Definition
(GenBank) LysR family regulatory protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_24
Motif
Other DBs
NCBI-ProteinID: CAR54384
UniProt: B4EKH0
Position
2:complement(583416..584306)
Genome map
AA seq 296 aa AA seqDB search
MPPRPSRLPPLNALRAFEVSARHLNFRAAADEIGVTQGAVAQQVRHLEDVLGLKLFERLP
RGLALTHDGAAYFSDVQRALHAIADATDKLVKRRAALTISTTPSFASKWLIPRLAQFTDA
HPDYDVRVIADPQIATFRHDGVDLAIRYGKPPFGKHLATHALFPLDVYAVCSPSVLTAPA
SPRALAGQVLLHDAHDLWPEFLAAMPEPVDVDPHKGLRFNQTSLAIDAAVAGQGIALATE
PLVERDIAAGRLCKPFVFAFPLSMGFYLVYPAERRDDDAIAVMRAWMIQAASDGRP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgccgccacgcccttcccgcctgccgccgctgaatgcgcttcgtgcgttcgaagtgtcc
gcgcggcacctcaatttccgcgccgccgccgacgagatcggtgtcacgcagggcgccgtc
gcgcagcaggtgcgccacctcgaggacgtgctcggcctgaagctgttcgagcgcctgccg
cgcggcctcgcgctcacgcacgacggcgccgcgtacttctccgacgtgcagcgcgcgctg
catgcgatcgccgacgcgaccgacaagctcgtcaagcgccgcgccgcgctgacgatcagc
acgacgccgtcgttcgcgtcgaagtggctgatcccgcggctcgcgcagttcaccgacgcg
catcccgactacgacgtgcgcgtgatcgccgatccgcagatcgcgacgttccgccacgac
ggcgtcgacctcgcgatccgctacggcaagccgccgttcggcaagcatctcgccacccat
gcgctgttcccgctcgacgtgtacgcggtgtgcagcccgtcggtgctgaccgcgccggct
tcgccgcgcgcgctcgctggccaggtgctgctgcacgacgcgcacgatctgtggcccgaa
ttcctcgcggcgatgcccgaaccggtcgacgtcgatccgcacaaggggctgcgcttcaac
cagacgtcgctcgcgatcgacgcggccgtcgccggccagggcatcgcgctcgcgaccgag
ccgctcgtcgagcgcgacatcgccgccggacggctgtgcaagccgttcgtcttcgcgttt
ccgctgtcgatggggttctatctcgtgtatccggccgagcgccgcgacgacgacgcgatc
gcggtgatgcgcgcgtggatgatccaggccgcgtcggacgggcggccttga

DBGET integrated database retrieval system