KEGG   Burkholderia cenocepacia J2315: BCAM0529Help
Entry
BCAM0529          CDS       T00771                                 

Definition
(GenBank) putative hydrolase
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EHN Abhydrolase_1 Abhydrolase_6 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: CAR54386
UniProt: B4EKH2
Position
2:585349..586626
Genome map
AA seq 425 aa AA seqDB search
MSSTPFSPMRRHLLATSVAAGVSAMLPTALHAATGASGIRPFTAHIPDEAVADLRRRIAA
TRWPGRETVADESQGVRLARMQALLRYWGTDYDWRKGEARLNGFPMFITEIDGLDIHFIH
VRSRHENAMPMIMTHGWPGSIFELLKAIGPLTDPTAHGASADDAFHVVVPSLPGFGFSGR
PTKTGWGSDHIARAWGELMARLGYTRFVSQGGDCGSVISHRMAMQRVQGLAGIHVNMPAT
VPPDIATLLATDAPAPASLSPKEKAAYEKLATFYRDNCGYSAMMVTRPQTVGYALADSPS
GQAAWMYDKISQWTYSGGVPERSIPRDEILDDISLYWLTNTATSAAQIYWEDHSNNFNAV
DISLPAAITVFPGEIYQAPRSWAERSYHNLIYFNEVDKGGHFAAWEEPELFAREVRAGFR
PLRRV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccacaccgttttccccgatgcgtcgccacctgctggccacttccgtggccgcc
ggggtgtcggcgatgctgcccaccgcgctgcatgcggctaccggcgcgagcggcatacgc
ccgttcaccgcgcacattcccgatgaagccgtggccgacctgcgccgtcgcatcgccgcg
acgcgctggccgggccgcgagaccgtcgccgacgaatcgcagggcgtgcggctcgcgcgc
atgcaggcgctgctgcgctactggggcaccgactacgactggcgcaagggcgaggcgcgc
ctgaacggtttcccgatgttcatcacggaaatcgacgggctcgacattcatttcattcac
gtccgctcgcggcacgagaacgcgatgccgatgatcatgacgcacggctggcccggttcg
atcttcgagttgctgaaggcgatcggcccgctgaccgatccgaccgcgcacggcgcgagc
gcggacgatgcgttccatgtcgtcgtgccgtcgctgccgggtttcggtttctcgggccgg
ccgacgaagaccggctggggttcggatcacatcgcgcgcgcgtggggcgagctgatggcg
cggctcggctatacgcgcttcgtgtcgcagggcggcgactgcggctcggtgatctcgcac
cggatggcgatgcagcgcgtgcagggcctggccgggattcacgtgaacatgccggcgacg
gtgccgccggacatcgccacgctgctcgcgaccgatgcgcccgcgccggcttcgctgtcg
ccgaaggagaaggccgcgtacgagaagctcgcgacgttctatcgcgacaactgcggctac
tcggcgatgatggtcacgcggccgcagacggtcggttatgcgctggcggattcgccgtcc
ggacaggccgcgtggatgtacgacaagatctcgcagtggacgtacagcggcggcgtgccc
gaacgctcgattccgcgcgacgagattctcgacgacatttcgttgtactggttgaccaat
acagcgacgtcggccgcgcagatctactgggaggatcactcgaacaacttcaacgcggtc
gatatctcgttgccggcggcgatcacggtgtttccgggcgagatctatcaggcgccgcgc
agttgggccgagcgcagttatcacaacctgatctacttcaacgaagtcgacaagggcggg
cacttcgcggcatgggaggaaccggaattgttcgcgcgtgaagtgcgtgccgggttccgg
ccgttgcggcgcgtgtaa

DBGET integrated database retrieval system