KEGG   Burkholderia cenocepacia J2315: BCAM0531Help
Entry
BCAM0531          CDS       T00771                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00900  Terpenoid backbone biosynthesis
bcj01110  Biosynthesis of secondary metabolites
bcj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCAM0531 (mvaA)
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     BCAM0531 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: CAR54389
UniProt: B4EKH5
Position
2:588787..590073
Genome map
AA seq 428 aa AA seqDB search
MPIDSALPNFRSLTPEQRLSHLARVVGLDDAEHALLARPGALPLDTANGMIENVIGTFEL
PMAVTGYFRINDRDVIVPMAVEEPSIVAAASYMAKLSRAAGGFRTSSSGPLMRAQVQVVG
VDDPYGARLAILRHAAELIALANSRDKVLVGLGGGCRDIEVHVFPDTPRGAMIVAHLIVD
VRDAMGANTVNTMAETVATRIEAITGGQVRLRILSNLADLRLARAEVRYSAATLATDDYA
GEAVIDRVIDAYVFAATDPYRAATHNKGIMNGIDPVVVATGNDWRAVEAGAHAYASRSGR
YTSLTTWEKAANGDLVGTIEMPMPVGLVGGATKTHPLARLALKIMNVTSAQELGEIAVAV
GLAQNLGALRALATEGIQRGHMALHARNIAVAAGATGADIDRIAQRMVAAKDVRTDFAVE
LLAGRSDG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcgattccgccttgccgaacttccgctcgctgacgcccgagcaacgcctgtcc
cacctggcccgcgtcgtcgggctcgacgatgccgagcacgcgctgctcgcccgaccgggc
gcgctgccgctcgataccgcgaacggaatgatcgagaacgtgatcggcacgttcgagctg
ccgatggcggtgaccggctacttccggatcaacgaccgggacgtgatcgtgccgatggcc
gtcgaggagccgtcgatcgtggcggccgcatcgtacatggcgaagctgtcgcgcgcggcg
ggcggcttccgcacgtcgagcagcggcccgctgatgcgtgcgcaggtccaggtggtcggc
gtcgacgatccgtacggcgcgcggctcgcgatcctgcgtcatgcggccgaactgatcgcg
ctcgcgaacagccgcgacaaggtgctggtcgggctcggcggcggctgccgcgacatcgag
gttcatgtgtttcccgacacgccgcgcggcgcgatgatcgtcgcgcacctgatcgtcgac
gtgcgcgacgcgatgggcgcgaacacggtcaacacgatggccgagaccgtcgcgacgcgc
atcgaggcgattaccggcggccaggtacggttgcggatactgtccaacctcgccgacctg
cggctggcgcgcgcggaggtacggtactcggccgcgacgctcgcgaccgacgattacgcc
ggcgaagcggtgatcgaccgtgtgatcgacgcatacgtgttcgcggccaccgatccgtac
cgcgcggcgacccacaacaagggcatcatgaacggcatcgatccggtggtggtcgcgacc
ggcaacgactggcgcgcggtcgaagccggcgcgcatgcgtacgcgagccgcagcggccgc
tatacgtcgctgacgacgtgggagaaggccgcgaacggcgacctcgtcggcacgatcgag
atgccgatgccggtcgggctcgtcggcggcgcgacgaagacgcatccgctcgcgcgcctc
gcattgaagatcatgaacgtgacgtccgcgcaggaactcggcgaaattgcggtcgcggtc
gggcttgcgcagaatctcggggcgctgcgtgcgctcgcgaccgaagggatccagcgcggc
cacatggcactgcatgcgcgcaacatcgccgtcgcggccggcgcgacgggcgccgacatc
gaccggatcgcgcagcggatggtcgcggcgaaggacgtgcgtaccgatttcgccgtcgag
ctgctcgcaggccgcagcgacggctga

DBGET integrated database retrieval system