KEGG   Burkholderia cenocepacia J2315: BCAM0537Help
Entry
BCAM0537          CDS       T00771                                 

Definition
(GenBank) serine peptidase, family S33
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_5 Abhydrolase_1 Ser_hydrolase Hydrolase_4 DLH Glyco_hydro_3_C Fcf1
Motif
Other DBs
NCBI-ProteinID: CAR54395
UniProt: B4EKI1
Position
2:594599..595390
Genome map
AA seq 263 aa AA seqDB search
MAGLTKRVLVSAAMIGGLFGAVAAQAAPKEDLKGTNVVLVHGAFADGSSWNRVIPLLEAR
GLHVVSVQNPLSSLADDAAAAKRTIDEQKGPVVLVGHSWAGVVISDAGNDDKVKSLVYVA
AFAPDNGQSIADVTQGLPAPAWAGELRKDAGGFARLSDKAIAQDFAPDLPPAQQRLVAAT
QGPWYGGCISEKVTQAAWHAKPSTFVVATQDRMIDPTLQEAMAKRIGATVTRVNASHVAM
LSQPKAVADAIIAAAERAKQDTQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggccggtttgacgaaacgcgttctggtatccgccgcgatgatcggcggactgttcggt
gcggtcgcggcgcaggccgcgccgaaggaagacctgaagggcaccaacgtcgtgctcgtg
cacggcgcgttcgccgacggatcgagctggaaccgcgtgattccgctgctggaagcgcgc
gggctgcacgtggtgtcggtgcagaatccgctgagctcgctcgccgacgatgcggccgcg
gcgaagcgtacgatcgacgaacagaaggggccggtcgtgctggtcggccattcgtgggcg
ggcgtcgtgatcagcgacgcgggcaacgacgacaaggtgaagtcgctcgtgtacgtcgcg
gcgttcgcccccgacaacggccagtcgatcgcggacgtcacgcaggggctgccggcgccg
gcatgggccggcgagttgcgcaaggacgcgggcggtttcgcacggctgtcggacaaggcg
atcgcgcaggacttcgcgccggatctgccgcccgcgcagcagcgcctcgtcgcggcgacc
caggggccgtggtatggcggatgcatttcggagaaggtcacgcaggccgcgtggcatgcg
aagccgtcgacgttcgtcgtcgcgacgcaggaccggatgatcgacccgacgctgcaggaa
gcgatggcgaagcggatcggcgcgacggtcacgcgcgtgaacgcgagccacgtcgcgatg
ttgagccagccgaaggccgtggccgacgcgatcatcgccgcggccgagcgcgcgaagcag
gatacgcagtga

DBGET integrated database retrieval system