KEGG   Burkholderia cenocepacia J2315: BCAM0538Help
Entry
BCAM0538          CDS       T00771                                 

Definition
(GenBank) putative amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00330  Arginine and proline metabolism
bcj00360  Phenylalanine metabolism
bcj00380  Tryptophan metabolism
bcj00627  Aminobenzoate degradation
bcj00643  Styrene degradation
bcj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BCAM0538
   00360 Phenylalanine metabolism
    BCAM0538
   00380 Tryptophan metabolism
    BCAM0538
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BCAM0538
   00643 Styrene degradation
    BCAM0538
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BCAM0538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CAR54396
UniProt: B4EKI2
Position
2:595466..596866
Genome map
AA seq 466 aa AA seqDB search
MTELWQLSATELAKRVRQRDVSAREVADAVLDRLDAVNPAINAVVEHRPDDVRQQADEVD
RAIARGDDPGPLAGVPVTVKINVDQAGFATTNGTRLQRNLVAPADSPVVANIRKAGGVLL
GRTNSPTFALRWFTANLVHGHTRNPRNASLTPGGSSGGAAAAVAAGIGPLAVGTDIGGSV
RYPAYACGVHGIRPSLGRVPAFNASSPERAIGAQLMSTAGPIARTIDDLSLALRAFSAPD
PRDPWHVAVPFDGREVPKRAALCVRPRGLEVVPEVEAALRDAARRLVDAGWTVDEIDDTP
PMREAALLQEQLWLGDGFDALANAVAQDGDPGAAAVIAAVRGKVRDLPADVISRALVRRT
TLTRAWRLFLDDYAVLLLPVSAELPFPDDLDRQGPDGFERVWEAQLTLRALPAMGLPGLA
VTTSIVNGVPVGVQVVATHHREDLCLLAGRDIEARGVPIVPVDPVV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactctggcaactgtccgcgaccgaactcgcgaaacgcgtgcggcagcgggac
gtatccgcgcgcgaagtggcagacgcggtgctcgatcgtctcgatgccgtgaatccggcg
atcaacgcggtggtcgaacaccgtcccgacgacgtgcggcagcaggccgacgaagtcgat
cgcgcgatcgcgcgcggcgacgatccggggccgctcgcgggcgtccccgtcaccgtgaag
atcaacgtcgatcaggccggctttgcgacgaccaacggcacgcgtttgcagcgcaatctg
gtcgcgcccgccgacagcccggtggtcgcgaacatccggaaggccggcggggtgctgctc
ggccgcaccaattccccgacgttcgcattgcgctggttcacggcgaatctcgtgcacggc
cacacgcgcaatccgcgcaatgcgtcgctgacgccgggcggatcgagcggcggcgcggcg
gcggccgtggctgccgggatcggcccgctcgcggtcggcactgacatcggcggctcggtg
cgctacccggcctatgcatgcggcgtacacgggatccggccgtcgctcggccgcgtgccg
gcattcaatgcatcgtcgcccgagcgggcgatcggcgcgcaactgatgtcgacggccggg
ccgatcgcgcgcacgatcgacgatctctcgctcgcgctacgcgccttctccgcgccggat
ccgcgcgatccgtggcacgtcgcggtgccgttcgacgggcgcgaggtgccgaagcgcgcg
gcgctgtgcgtgcgtccgcgcggcctggaggtcgtgcccgaagtcgaggccgcgctgcgc
gatgccgcgcgccggctggtcgatgccggctggaccgtcgacgagatcgacgatacgccg
ccgatgcgcgaggccgcgctgctgcaggaacagctgtggctcggcgacggattcgacgcg
ctggcgaacgccgtggcgcaagacggcgatccgggcgcggccgcggtgatcgccgccgtg
cgcggcaaggtgcgcgacctgccggccgacgtgatcagccgcgcgctggtccggcgtacc
acgctgacgcgagcgtggcggctgtttctcgacgactatgcggtgctgctgttgcccgtt
tcggcggaactgccgttccccgacgatctcgaccggcaagggccggacggcttcgagcgc
gtgtgggaagcgcagctcacgttgcgcgcgctgcccgcgatggggctgccggggctggcc
gttacgacatcgatcgtgaacggcgtgccggtgggcgtgcaggtggtggccacgcatcat
cgcgaggatctgtgtctgcttgccgggcgcgatattgaagcgcgcggggtgccgattgtg
ccggtcgatccagtggtatga

DBGET integrated database retrieval system