KEGG   Burkholderia cenocepacia J2315: BCAM0539Help
Entry
BCAM0539          CDS       T00771                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: CAR54397
UniProt: B4EKI3
Position
2:597224..597694
Genome map
AA seq 156 aa AA seqDB search
MTVELEERTAAQQALEDARAAAVAAGTPYAGGVAPEAAWALLSAGDALLVDVRTAEERKF
VGYVPESLHVPWATGTSLTRNPRFVRELEAKTGKDAVVLLLCRSGNRSAQAAEAAAKAGF
TQVFNVLEGFEGDLDERQHRGGQNGWRFRGLPWAQD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgaactggaagaacgaaccgccgcgcagcaggcgctcgaagacgcgcgcgcg
gcagccgtggcggccggcacgccctatgcgggcggcgtcgcgccggaagccgcgtgggcg
ctgctctcggcgggcgatgcgttgctggtggacgtgcgcacggccgaggaacggaaattc
gtcggttacgtgcctgaatcgctgcacgtgccgtgggcgaccggcacgagcctgacgcgc
aacccgcgcttcgtgcgcgaactggaagcgaagaccggcaaggacgcggtcgtgctgttg
ttgtgccgcagcggcaaccgctcggcgcaggcggccgaggccgcggcgaaggcgggcttc
acgcaggttttcaatgtgctcgaaggcttcgagggcgacctcgacgagcggcagcatcgc
ggcggccaaaacggctggcgcttccgcggcctgccttgggcgcaggattga

DBGET integrated database retrieval system